diff --git a/CHANGELOG.md b/CHANGELOG.md index 1f733203..b31f43d9 100644 --- a/CHANGELOG.md +++ b/CHANGELOG.md @@ -1,3 +1,14 @@ +# biobox x.x.x + +## NEW FUNCTIONALITY + +* `agat`: + - `agat/agat_convert_genscan2gff`: convert a genscan file into a GFF file (PR #100). + +## MINOR CHANGES + +* Upgrade to Viash 0.9.0. + # biobox 0.2.0 ## BREAKING CHANGES diff --git a/_viash.yaml b/_viash.yaml index ab4f3828..d08f2fb2 100644 --- a/_viash.yaml +++ b/_viash.yaml @@ -7,7 +7,7 @@ links: issue_tracker: https://github.com/viash-hub/biobox/issues repository: https://github.com/viash-hub/biobox -viash_version: 0.9.0-RC7 +viash_version: 0.9.0 config_mods: | .requirements.commands := ['ps'] diff --git a/src/agat/agat_convert_genscan2gff/config.vsh.yaml b/src/agat/agat_convert_genscan2gff/config.vsh.yaml new file mode 100644 index 00000000..2adce1da --- /dev/null +++ b/src/agat/agat_convert_genscan2gff/config.vsh.yaml @@ -0,0 +1,95 @@ +name: agat_convert_genscan2gff +namespace: agat +description: | + The script takes a GENSCAN file as input, and will translate it in gff + format. The GENSCAN format is described [here](http://genome.crg.es/courses/Bioinformatics2003_genefinding/results/genscan.html). + + **Known problem** + + You must have submited only DNA sequence, without any header!! Indeed the tool expects only DNA + sequences and does not crash/warn if an header is submited along the + sequence. e.g If you have an header ">seq" s-e-q are seen as the 3 first + nucleotides of the sequence. Then all prediction location are shifted + accordingly. (checked only on the [online version](http://argonaute.mit.edu/GENSCAN.html). + I don't know if there is the same problem elsewhere.) +keywords: [gene annotations, GFF conversion, GENSCAN] +links: + homepage: https://github.com/NBISweden/AGAT + documentation: https://agat.readthedocs.io/en/latest/tools/agat_convert_genscan2gff.html + issue_tracker: https://github.com/NBISweden/AGAT/issues + repository: https://github.com/NBISweden/AGAT +references: + doi: 10.5281/zenodo.3552717 +license: GPL-3.0 +requirements: + - commands: [agat] +authors: + - __merge__: /src/_authors/leila_paquay.yaml + roles: [ author, maintainer ] + +argument_groups: + - name: Inputs + arguments: + - name: --genscan + alternatives: [-g] + description: Input genscan bed file that will be converted. + type: file + required: true + direction: input + - name: Outputs + arguments: + - name: --output + alternatives: [-o, --out, --outfile, --gff] + description: Output GFF file. If no output file is specified, the output will be written to STDOUT. + type: file + direction: output + required: true + example: output.gff + - name: Arguments + arguments: + - name: --source + description: | + The source informs about the tool used to produce the data and is stored in 2nd field of a gff file. Example: Stringtie, Maker, Augustus, etc. [default: data] + type: string + required: false + example: Stringtie + - name: --primary_tag + description: | + The primary_tag corresponds to the data type and is stored in 3rd field of a gff file. Example: gene, mRNA, CDS, etc. [default: gene] + type: string + required: false + example: gene + - name: --inflate_type + description: | + Feature type (3rd column in gff) created when inflate parameter activated [default: exon]. + type: string + required: false + example: exon + - name: --verbose + description: add verbosity + type: boolean_true + - name: --config + alternatives: [-c] + description: | + AGAT config file. By default AGAT takes the original agat_config.yaml shipped with AGAT. The `--config` option gives you the possibility to use your own AGAT config file (located elsewhere or named differently). + type: file + required: false + example: custom_agat_config.yaml +resources: + - type: bash_script + path: script.sh +test_resources: + - type: bash_script + path: test.sh + - type: file + path: test_data +engines: + - type: docker + image: quay.io/biocontainers/agat:1.4.0--pl5321hdfd78af_0 + setup: + - type: docker + run: | + agat --version | sed 's/AGAT\s\(.*\)/agat: "\1"/' > /var/software_versions.txt +runners: + - type: executable + - type: nextflow \ No newline at end of file diff --git a/src/agat/agat_convert_genscan2gff/help.txt b/src/agat/agat_convert_genscan2gff/help.txt new file mode 100644 index 00000000..8a9e9f52 --- /dev/null +++ b/src/agat/agat_convert_genscan2gff/help.txt @@ -0,0 +1,94 @@ +```sh +agat_convert_genscan2gff.pl --help +``` + ------------------------------------------------------------------------------ +| Another GFF Analysis Toolkit (AGAT) - Version: v1.4.0 | +| https://github.com/NBISweden/AGAT | +| National Bioinformatics Infrastructure Sweden (NBIS) - www.nbis.se | + ------------------------------------------------------------------------------ + +Name: + agat_convert_genscan2gff.pl + +Description: + The script takes a genscan file as input, and will translate it in gff + format. The genscan format is described here: + http://genome.crg.es/courses/Bioinformatics2003_genefinding/results/gens + can.html /!\ vvv Known problem vvv /!\ You must have submited only DNA + sequence, wihtout any header!! Indeed the tool expects only DNA + sequences and does not crash/warn if an header is submited along the + sequence. e.g If you have an header ">seq" s-e-q are seen as the 3 first + nucleotides of the sequence. Then all prediction location are shifted + accordingly. (checked only on the online version + http://argonaute.mit.edu/GENSCAN.html. I don't know if there is the same + pronlem elsewhere.) /!\ ^^^ Known problem ^^^^ /!\ + +Usage: + agat_convert_genscan2gff.pl --genscan infile.bed [ -o outfile ] + agat_convert_genscan2gff.pl -h + +Options: + --genscan or -g + Input genscan bed file that will be convert. + + --source + The source informs about the tool used to produce the data and + is stored in 2nd field of a gff file. Example: + Stringtie,Maker,Augustus,etc. [default: data] + + --primary_tag + The primary_tag corresponf to the data type and is stored in 3rd + field of a gff file. Example: gene,mRNA,CDS,etc. [default: gene] + + --inflate_off + By default we inflate the block fields (blockCount, blockSizes, + blockStarts) to create subfeatures of the main feature + (primary_tag). Type of subfeature created based on the + inflate_type parameter. If you don't want this inflating + behaviour you can deactivate it by using the option + --inflate_off. + + --inflate_type + Feature type (3rd column in gff) created when inflate parameter + activated [default: exon]. + + --verbose + add verbosity + + -o , --output , --out , --outfile or --gff + Output GFF file. If no output file is specified, the output will + be written to STDOUT. + + -c or --config + String - Input agat config file. By default AGAT takes as input + agat_config.yaml file from the working directory if any, + otherwise it takes the orignal agat_config.yaml shipped with + AGAT. To get the agat_config.yaml locally type: "agat config + --expose". The --config option gives you the possibility to use + your own AGAT config file (located elsewhere or named + differently). + + -h or --help + Display this helpful text. + +Feedback: + Did you find a bug?: + Do not hesitate to report bugs to help us keep track of the bugs and + their resolution. Please use the GitHub issue tracking system available + at this address: + + https://github.com/NBISweden/AGAT/issues + + Ensure that the bug was not already reported by searching under Issues. + If you're unable to find an (open) issue addressing the problem, open a new one. + Try as much as possible to include in the issue when relevant: + - a clear description, + - as much relevant information as possible, + - the command used, + - a data sample, + - an explanation of the expected behaviour that is not occurring. + + Do you want to contribute?: + You are very welcome, visit this address for the Contributing + guidelines: + https://github.com/NBISweden/AGAT/blob/master/CONTRIBUTING.md diff --git a/src/agat/agat_convert_genscan2gff/script.sh b/src/agat/agat_convert_genscan2gff/script.sh new file mode 100644 index 00000000..38afb084 --- /dev/null +++ b/src/agat/agat_convert_genscan2gff/script.sh @@ -0,0 +1,21 @@ +#!/bin/bash + +set -eo pipefail + +## VIASH START +## VIASH END + +# unset flags +[[ "$par_inflate_off" == "true" ]] && unset par_inflate_off +[[ "$par_verbose" == "false" ]] && unset par_verbose + +# run agat_convert_genscan2gff +agat_convert_genscan2gff.pl \ + --genscan "$par_genscan" \ + --output "$par_output" \ + ${par_source:+--source "${par_source}"} \ + ${par_primary_tag:+--primary_tag "${par_primary_tag}"} \ + ${par_inflate_off:+--inflate_off} \ + ${par_inflate_type:+--inflate_type "${par_inflate_type}"} \ + ${par_verbose:+--verbose} \ + ${par_config:+--config "${par_config}"} \ No newline at end of file diff --git a/src/agat/agat_convert_genscan2gff/test.sh b/src/agat/agat_convert_genscan2gff/test.sh new file mode 100644 index 00000000..b666dacf --- /dev/null +++ b/src/agat/agat_convert_genscan2gff/test.sh @@ -0,0 +1,35 @@ +#!/bin/bash + +set -eo pipefail + +## VIASH START +## VIASH END + +test_dir="${meta_resources_dir}/test_data" + +# create temporary directory and clean up on exit +TMPDIR=$(mktemp -d "$meta_temp_dir/$meta_name-XXXXXX") +function clean_up { + [[ -d "$TMPDIR" ]] && rm -rf "$TMPDIR" +} +trap clean_up EXIT + +echo "> Run $meta_name with test data" +"$meta_executable" \ + --genscan "$test_dir/test.genscan" \ + --output "$TMPDIR/output.gff" + +echo ">> Checking output" +[ ! -f "$TMPDIR/output.gff" ] && echo "Output file output.gff does not exist" && exit 1 + +echo ">> Check if output is empty" +[ ! -s "$TMPDIR/output.gff" ] && echo "Output file output.gff is empty" && exit 1 + +echo ">> Check if output matches expected output" +diff "$TMPDIR/output.gff" "$test_dir/agat_convert_genscan2gff_1.gff" +if [ $? -ne 0 ]; then + echo "Output file output.gff does not match expected output" + exit 1 +fi + +echo "> Test successful" diff --git a/src/agat/agat_convert_genscan2gff/test_data/agat_convert_genscan2gff_1.gff b/src/agat/agat_convert_genscan2gff/test_data/agat_convert_genscan2gff_1.gff new file mode 100644 index 00000000..695fb46c --- /dev/null +++ b/src/agat/agat_convert_genscan2gff/test_data/agat_convert_genscan2gff_1.gff @@ -0,0 +1,25 @@ +##gff-version 3 +unknown genscan gene 2223 4605 75.25 + . ID=gene_1 +unknown genscan mRNA 2223 4605 75.25 + . ID=mrna_1;Parent=gene_1 +unknown genscan exon 2223 3020 75.25 + . ID=exon_1;Parent=mrna_1 +unknown genscan exon 4249 4605 13.03 + . ID=exon_2;Parent=mrna_1 +unknown genscan CDS 2223 3020 75.25 + 0 ID=cds_1;Parent=mrna_1 +unknown genscan CDS 4249 4605 13.03 + 0 ID=cds_2;Parent=mrna_1 +unknown genscan gene 6829 8789 20.06 - . ID=gene_2 +unknown genscan mRNA 6829 8789 20.06 - . ID=mrna_2;Parent=gene_2 +unknown genscan exon 6829 7297 20.06 - . ID=exon_3;Parent=mrna_2 +unknown genscan exon 7730 7888 12.78 - . ID=exon_4;Parent=mrna_2 +unknown genscan exon 8029 8185 7.45 - . ID=exon_5;Parent=mrna_2 +unknown genscan exon 8278 8546 17.45 - . ID=exon_6;Parent=mrna_2 +unknown genscan exon 8647 8789 18.65 - . ID=exon_7;Parent=mrna_2 +unknown genscan CDS 6829 7297 20.06 - 1 ID=cds_3;Parent=mrna_2 +unknown genscan CDS 7730 7888 12.78 - 1 ID=cds_4;Parent=mrna_2 +unknown genscan CDS 8029 8185 7.45 - 2 ID=cds_5;Parent=mrna_2 +unknown genscan CDS 8278 8546 17.45 - 1 ID=cds_6;Parent=mrna_2 +unknown genscan CDS 8647 8789 18.65 - 0 ID=cds_7;Parent=mrna_2 +unknown genscan gene 10209 11924 16.18 + . ID=gene_3 +unknown genscan mRNA 10209 11924 16.18 + . ID=mrna_3;Parent=gene_3 +unknown genscan exon 10209 11313 16.18 + . ID=exon_8;Parent=mrna_3 +unknown genscan exon 11850 11924 3.27 + . ID=exon_9;Parent=mrna_3 +unknown genscan CDS 10209 11313 16.18 + 0 ID=cds_8;Parent=mrna_3 +unknown genscan CDS 11850 11924 3.27 + 2 ID=cds_9;Parent=mrna_3 diff --git a/src/agat/agat_convert_genscan2gff/test_data/script.sh b/src/agat/agat_convert_genscan2gff/test_data/script.sh new file mode 100755 index 00000000..c1693653 --- /dev/null +++ b/src/agat/agat_convert_genscan2gff/test_data/script.sh @@ -0,0 +1,11 @@ +#!/bin/bash + +# clone repo +if [ ! -d /tmp/agat_source ]; then + git clone --depth 1 --single-branch --branch master https://github.com/NBISweden/AGAT /tmp/agat_source +fi + +# copy test data +cp -r /tmp/agat_source/t/scripts_output/in/test.genscan src/agat/agat_convert_genscan2gff/test_data/test.genscan +cp -r /tmp/agat_source/t/scripts_output/out/agat_convert_genscan2gff_1.gff src/agat/agat_convert_genscan2gff/test_data/agat_convert_genscan2gff_1.gff + diff --git a/src/agat/agat_convert_genscan2gff/test_data/test.genscan b/src/agat/agat_convert_genscan2gff/test_data/test.genscan new file mode 100644 index 00000000..a88037db --- /dev/null +++ b/src/agat/agat_convert_genscan2gff/test_data/test.genscan @@ -0,0 +1,127 @@ +GENSCAN 1.0 Date run: 7-Mar-120 Time: 14:46:49 + + + +Sequence /tmp/03_07_20-14:46:49.fasta : 12217 bp : 42.83% C+G : Isochore 1 ( 0 - 43 C+G%) + + + +Parameter matrix: HumanIso.smat + + + +Predicted genes/exons: + + + +Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr.. + +----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------ + + + + 1.01 Init + 2223 3020 798 2 0 55 2 924 0.940 75.25 + + 1.02 Term + 4249 4605 357 0 0 26 38 307 0.976 13.03 + + 1.03 PlyA + 4711 4716 6 -0.45 + + + + 2.06 PlyA - 4852 4847 6 -0.45 + + 2.05 Term - 7297 6829 469 0 1 13 42 387 0.281 20.06 + + 2.04 Intr - 7888 7730 159 0 0 85 93 144 0.998 12.78 + + 2.03 Intr - 8185 8029 157 2 1 65 60 144 0.787 7.45 + + 2.02 Intr - 8546 8278 269 1 2 36 65 287 0.946 17.45 + + 2.01 Init - 8789 8647 143 2 2 94 96 176 0.550 18.65 + + 2.00 Prom - 9720 9681 40 -6.55 + + + + 3.00 Prom + 10160 10199 40 -11.84 + + 3.01 Init + 10209 11313 1105 2 1 66 57 269 0.512 16.18 + + 3.02 Intr + 11850 11924 75 1 0 80 86 57 0.507 3.27 + + + +Suboptimal exons with probability > 1.000 + + + +Exnum Type S .Begin ...End .Len Fr Ph B/Ac Do/T CodRg P.... Tscr.. + +----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------ + + + +NO EXONS FOUND AT GIVEN PROBABILITY CUTOFF + + + + + +Predicted peptide sequence(s): + + + + + +>/tmp/03_03_20-07:33:11.fasta|GENSCAN_predicted_peptide_1|384_aa + +MSSKNKVSKQDIDSIVESLMKKQKSYFEPRLAQIQQVGMENVQKLSAIHAELALLTASIS + +TVKSDVDKLKCKVENNFSAIDGHDQAFGELELKMADMEDRSRRCNIRVIGLKERLEGFNA + +IQYLTHSLPKWFPALADVPVEVMSAHRIYSDAKRGDNRTLIFNVLRYTTRQAILRAAKKD + +PLSVDDRKVRFSPDYSNFTVKRCQAFHQAKDAARNKCLDFFLLYPATLKIKEGAQYRSFT + +SPKEAEDYVNSAASNHAATPASPRQHGTILTIYRRIHSLYDGERARKIQLLEQAASVALT + +GDNWTSVRNDNYLGVTAHFIDNVWKLRCFALEVKKKKKHSRHTAEDCAEEFIDVSNRWEI + +NGKLTTLGTDSALIMLAAARLLPF + + + +>/tmp/03_03_20-07:33:11.fasta|GENSCAN_predicted_peptide_2|398_aa + +MASTMPSSSSTEDEENTPECLNKDHYHFHHYTMEYIQDKPTNVARVGGFTDKKSIAKVER + +CLARERQEATEDHEAIPSTSGATSLTKKLRSRSGLPIAGSGLVLPALCIICQKKEKFINR + +AGKRQRDPLSKAETLTVGQLQKAAELKDDQSILLHIKDKDCVALEVQYHKGCYNQYTRFM + +TRPEKPEKEQNEPTFDVGYKILCERIIRQRLLVNQEVLRMGQLRMAFIELVKANEGLDAS + +NYSIKNLERSRRADAGSQRIQIFDPDQRTPTQWKKFLSEGTKKEALAEFLYVAWKNADLT + +IVGKNLCLYIAHTNQCHCVTVKEGVQSVRVVEDLLLFLHAQHAAREHKAVIIKSSDTDVA + +VIAVSVQTDLPCSLYVFTGTGNRTRIIDITKVSSANKI + + + +>/tmp/03_03_20-07:33:11.fasta|GENSCAN_predicted_peptide_3|394_aa + +MQRGRAAGINGIPPEFYVAFWEQLSPFFLHMINFSIEKGGFLRDVNTALISLLMKKDKNP + +TDCSSYRPLSLLNSDVKIFAKLLPLRLEPHMPELVSSDQTGFIKSRTAADNIRRLLHIIA + +AAPGCETPMSVLSLDAMKAFDRLEWSFLWSVLEAMGFISTFIGMVKVLYSNPSARVLTGQ + +TFSSLFPVSRSSRQGCPLSPALFVLSLEPLAQAVRLSNLVLPICICDTQHKLSLFADDVI + +VFLEHPTQSLPHFLSICEEFRKLSGFKMNWSKSALMHLNDNARKSVTPVNIPLVGQLKYL + +GIEVFPSLNQIVKHNYSLAFTNVLKDMDRWISLPMSIQARISIIKMNGLPRIHFVSSMVP + +LPPPSDYWIKISAQGVRCPLAKPFTHSPYSKTKX diff --git a/target/executable/agat/agat_convert_bed2gff/.config.vsh.yaml b/target/executable/agat/agat_convert_bed2gff/.config.vsh.yaml index f06ca315..25befac6 100644 --- a/target/executable/agat/agat_convert_bed2gff/.config.vsh.yaml +++ b/target/executable/agat/agat_convert_bed2gff/.config.vsh.yaml @@ -234,15 +234,16 @@ build_info: engine: "docker|native" output: "target/executable/agat/agat_convert_bed2gff" executable: "target/executable/agat/agat_convert_bed2gff/agat_convert_bed2gff" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/agat/agat_convert_bed2gff/agat_convert_bed2gff b/target/executable/agat/agat_convert_bed2gff/agat_convert_bed2gff index fbe0cb01..fa2df928 100755 --- a/target/executable/agat/agat_convert_bed2gff/agat_convert_bed2gff +++ b/target/executable/agat/agat_convert_bed2gff/agat_convert_bed2gff @@ -2,9 +2,9 @@ # agat_convert_bed2gff main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -515,9 +515,9 @@ RUN agat --version | sed 's/AGAT\s\(.*\)/agat: "\1"/' > /var/software_versions.t LABEL org.opencontainers.image.authors="Leïla Paquay" LABEL org.opencontainers.image.description="Companion container for running component agat agat_convert_bed2gff" -LABEL org.opencontainers.image.created="2024-09-16T07:55:16Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:34Z" LABEL org.opencontainers.image.source="https://github.com/NBISweden/AGAT" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/agat/agat_convert_embl2gff/.config.vsh.yaml b/target/executable/agat/agat_convert_embl2gff/.config.vsh.yaml index 85871ce1..618bfac0 100644 --- a/target/executable/agat/agat_convert_embl2gff/.config.vsh.yaml +++ b/target/executable/agat/agat_convert_embl2gff/.config.vsh.yaml @@ -224,15 +224,16 @@ build_info: engine: "docker|native" output: "target/executable/agat/agat_convert_embl2gff" executable: "target/executable/agat/agat_convert_embl2gff/agat_convert_embl2gff" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/agat/agat_convert_embl2gff/agat_convert_embl2gff b/target/executable/agat/agat_convert_embl2gff/agat_convert_embl2gff index d1bc6526..387c23e5 100755 --- a/target/executable/agat/agat_convert_embl2gff/agat_convert_embl2gff +++ b/target/executable/agat/agat_convert_embl2gff/agat_convert_embl2gff @@ -2,9 +2,9 @@ # agat_convert_embl2gff main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -505,9 +505,9 @@ RUN agat --version | sed 's/AGAT\s\(.*\)/agat: "\1"/' > /var/software_versions.t LABEL org.opencontainers.image.authors="Leïla Paquay" LABEL org.opencontainers.image.description="Companion container for running component agat agat_convert_embl2gff" -LABEL org.opencontainers.image.created="2024-09-16T07:55:16Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:33Z" LABEL org.opencontainers.image.source="https://github.com/NBISweden/AGAT" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/agat/agat_convert_genscan2gff/.config.vsh.yaml b/target/executable/agat/agat_convert_genscan2gff/.config.vsh.yaml new file mode 100644 index 00000000..356b6fce --- /dev/null +++ b/target/executable/agat/agat_convert_genscan2gff/.config.vsh.yaml @@ -0,0 +1,257 @@ +name: "agat_convert_genscan2gff" +namespace: "agat" +version: "main" +authors: +- name: "Leïla Paquay" + roles: + - "author" + - "maintainer" + info: + links: + email: "leila@data-intuitive.com" + github: "Leila011" + linkedin: "leilapaquay" + organizations: + - name: "Data Intuitive" + href: "https://www.data-intuitive.com" + role: "Software Developer" +argument_groups: +- name: "Inputs" + arguments: + - type: "file" + name: "--genscan" + alternatives: + - "-g" + description: "Input genscan bed file that will be converted." + info: null + must_exist: true + create_parent: true + required: true + direction: "input" + multiple: false + multiple_sep: ";" +- name: "Outputs" + arguments: + - type: "file" + name: "--output" + alternatives: + - "-o" + - "--out" + - "--outfile" + - "--gff" + description: "Output GFF file. If no output file is specified, the output will\ + \ be written to STDOUT." + info: null + example: + - "output.gff" + must_exist: true + create_parent: true + required: true + direction: "output" + multiple: false + multiple_sep: ";" +- name: "Arguments" + arguments: + - type: "string" + name: "--source" + description: "The source informs about the tool used to produce the data and is\ + \ stored in 2nd field of a gff file. Example: Stringtie, Maker, Augustus, etc.\ + \ [default: data]\n" + info: null + example: + - "Stringtie" + required: false + direction: "input" + multiple: false + multiple_sep: ";" + - type: "string" + name: "--primary_tag" + description: "The primary_tag corresponds to the data type and is stored in 3rd\ + \ field of a gff file. Example: gene, mRNA, CDS, etc. [default: gene]\n" + info: null + example: + - "gene" + required: false + direction: "input" + multiple: false + multiple_sep: ";" + - type: "string" + name: "--inflate_type" + description: "Feature type (3rd column in gff) created when inflate parameter\ + \ activated [default: exon].\n" + info: null + example: + - "exon" + required: false + direction: "input" + multiple: false + multiple_sep: ";" + - type: "boolean_true" + name: "--verbose" + description: "add verbosity" + info: null + direction: "input" + - type: "file" + name: "--config" + alternatives: + - "-c" + description: "AGAT config file. By default AGAT takes the original agat_config.yaml\ + \ shipped with AGAT. The `--config` option gives you the possibility to use\ + \ your own AGAT config file (located elsewhere or named differently).\n" + info: null + example: + - "custom_agat_config.yaml" + must_exist: true + create_parent: true + required: false + direction: "input" + multiple: false + multiple_sep: ";" +resources: +- type: "bash_script" + path: "script.sh" + is_executable: true +description: "The script takes a GENSCAN file as input, and will translate it in gff\n\ + format. The GENSCAN format is described [here](http://genome.crg.es/courses/Bioinformatics2003_genefinding/results/genscan.html).\n\ + \n**Known problem** \n\nYou must have submited only DNA sequence, without any header!!\ + \ Indeed the tool expects only DNA\nsequences and does not crash/warn if an header\ + \ is submited along the\nsequence. e.g If you have an header \">seq\" s-e-q are\ + \ seen as the 3 first\nnucleotides of the sequence. Then all prediction location\ + \ are shifted\naccordingly. (checked only on the [online version](http://argonaute.mit.edu/GENSCAN.html).\ + \ \nI don't know if there is the same problem elsewhere.)\n" +test_resources: +- type: "bash_script" + path: "test.sh" + is_executable: true +- type: "file" + path: "test_data" +info: null +status: "enabled" +requirements: + commands: + - "ps" +keywords: +- "gene annotations" +- "GFF conversion" +- "GENSCAN" +license: "GPL-3.0" +references: + doi: + - "10.5281/zenodo.3552717" +links: + repository: "https://github.com/NBISweden/AGAT" + homepage: "https://github.com/NBISweden/AGAT" + documentation: "https://agat.readthedocs.io/en/latest/tools/agat_convert_genscan2gff.html" + issue_tracker: "https://github.com/NBISweden/AGAT/issues" +runners: +- type: "executable" + id: "executable" + docker_setup_strategy: "ifneedbepullelsecachedbuild" +- type: "nextflow" + id: "nextflow" + directives: + tag: "$id" + auto: + simplifyInput: true + simplifyOutput: false + transcript: false + publish: false + config: + labels: + mem1gb: "memory = 1000000000.B" + mem2gb: "memory = 2000000000.B" + mem5gb: "memory = 5000000000.B" + mem10gb: "memory = 10000000000.B" + mem20gb: "memory = 20000000000.B" + mem50gb: "memory = 50000000000.B" + mem100gb: "memory = 100000000000.B" + mem200gb: "memory = 200000000000.B" + mem500gb: "memory = 500000000000.B" + mem1tb: "memory = 1000000000000.B" + mem2tb: "memory = 2000000000000.B" + mem5tb: "memory = 5000000000000.B" + mem10tb: "memory = 10000000000000.B" + mem20tb: "memory = 20000000000000.B" + mem50tb: "memory = 50000000000000.B" + mem100tb: "memory = 100000000000000.B" + mem200tb: "memory = 200000000000000.B" + mem500tb: "memory = 500000000000000.B" + mem1gib: "memory = 1073741824.B" + mem2gib: "memory = 2147483648.B" + mem4gib: "memory = 4294967296.B" + mem8gib: "memory = 8589934592.B" + mem16gib: "memory = 17179869184.B" + mem32gib: "memory = 34359738368.B" + mem64gib: "memory = 68719476736.B" + mem128gib: "memory = 137438953472.B" + mem256gib: "memory = 274877906944.B" + mem512gib: "memory = 549755813888.B" + mem1tib: "memory = 1099511627776.B" + mem2tib: "memory = 2199023255552.B" + mem4tib: "memory = 4398046511104.B" + mem8tib: "memory = 8796093022208.B" + mem16tib: "memory = 17592186044416.B" + mem32tib: "memory = 35184372088832.B" + mem64tib: "memory = 70368744177664.B" + mem128tib: "memory = 140737488355328.B" + mem256tib: "memory = 281474976710656.B" + mem512tib: "memory = 562949953421312.B" + cpu1: "cpus = 1" + cpu2: "cpus = 2" + cpu5: "cpus = 5" + cpu10: "cpus = 10" + cpu20: "cpus = 20" + cpu50: "cpus = 50" + cpu100: "cpus = 100" + cpu200: "cpus = 200" + cpu500: "cpus = 500" + cpu1000: "cpus = 1000" + debug: false + container: "docker" +engines: +- type: "docker" + id: "docker" + image: "quay.io/biocontainers/agat:1.4.0--pl5321hdfd78af_0" + target_registry: "images.viash-hub.com" + target_tag: "main" + namespace_separator: "/" + setup: + - type: "docker" + run: + - "agat --version | sed 's/AGAT\\s\\(.*\\)/agat: \"\\1\"/' > /var/software_versions.txt\n" + entrypoint: [] + cmd: null +- type: "native" + id: "native" +build_info: + config: "src/agat/agat_convert_genscan2gff/config.vsh.yaml" + runner: "executable" + engine: "docker|native" + output: "target/executable/agat/agat_convert_genscan2gff" + executable: "target/executable/agat/agat_convert_genscan2gff/agat_convert_genscan2gff" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" +package_config: + name: "biobox" + version: "main" + description: "A collection of bioinformatics tools for working with sequence data.\n" + info: null + viash_version: "0.9.0" + source: "src" + target: "target" + config_mods: + - ".requirements.commands := ['ps']\n" + - ".engines += { type: \"native\" }" + - ".engines[.type == 'docker'].target_registry := 'images.viash-hub.com'" + - ".engines[.type == 'docker'].target_tag := 'main'" + keywords: + - "bioinformatics" + - "modules" + - "sequencing" + license: "MIT" + organization: "vsh" + links: + repository: "https://github.com/viash-hub/biobox" + issue_tracker: "https://github.com/viash-hub/biobox/issues" diff --git a/target/executable/agat/agat_convert_genscan2gff/agat_convert_genscan2gff b/target/executable/agat/agat_convert_genscan2gff/agat_convert_genscan2gff new file mode 100755 index 00000000..adcf93d9 --- /dev/null +++ b/target/executable/agat/agat_convert_genscan2gff/agat_convert_genscan2gff @@ -0,0 +1,1252 @@ +#!/usr/bin/env bash + +# agat_convert_genscan2gff main +# +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. +# +# The component may contain files which fall under a different license. The +# authors of this component should specify the license in the header of such +# files, or include a separate license file detailing the licenses of all included +# files. +# +# Component authors: +# * Leïla Paquay (author, maintainer) + +set -e + +if [ -z "$VIASH_TEMP" ]; then + VIASH_TEMP=${VIASH_TEMP:-$VIASH_TMPDIR} + VIASH_TEMP=${VIASH_TEMP:-$VIASH_TEMPDIR} + VIASH_TEMP=${VIASH_TEMP:-$VIASH_TMP} + VIASH_TEMP=${VIASH_TEMP:-$TMPDIR} + VIASH_TEMP=${VIASH_TEMP:-$TMP} + VIASH_TEMP=${VIASH_TEMP:-$TEMPDIR} + VIASH_TEMP=${VIASH_TEMP:-$TEMP} + VIASH_TEMP=${VIASH_TEMP:-/tmp} +fi + +# define helper functions +# ViashQuote: put quotes around non flag values +# $1 : unquoted string +# return : possibly quoted string +# examples: +# ViashQuote --foo # returns --foo +# ViashQuote bar # returns 'bar' +# Viashquote --foo=bar # returns --foo='bar' +function ViashQuote { + if [[ "$1" =~ ^-+[a-zA-Z0-9_\-]+=.+$ ]]; then + echo "$1" | sed "s#=\(.*\)#='\1'#" + elif [[ "$1" =~ ^-+[a-zA-Z0-9_\-]+$ ]]; then + echo "$1" + else + echo "'$1'" + fi +} +# ViashRemoveFlags: Remove leading flag +# $1 : string with a possible leading flag +# return : string without possible leading flag +# examples: +# ViashRemoveFlags --foo=bar # returns bar +function ViashRemoveFlags { + echo "$1" | sed 's/^--*[a-zA-Z0-9_\-]*=//' +} +# ViashSourceDir: return the path of a bash file, following symlinks +# usage : ViashSourceDir ${BASH_SOURCE[0]} +# $1 : Should always be set to ${BASH_SOURCE[0]} +# returns : The absolute path of the bash file +function ViashSourceDir { + local source="$1" + while [ -h "$source" ]; do + local dir="$( cd -P "$( dirname "$source" )" >/dev/null 2>&1 && pwd )" + source="$(readlink "$source")" + [[ $source != /* ]] && source="$dir/$source" + done + cd -P "$( dirname "$source" )" >/dev/null 2>&1 && pwd +} +# ViashFindTargetDir: return the path of the '.build.yaml' file, following symlinks +# usage : ViashFindTargetDir 'ScriptPath' +# $1 : The location from where to start the upward search +# returns : The absolute path of the '.build.yaml' file +function ViashFindTargetDir { + local source="$1" + while [[ "$source" != "" && ! -e "$source/.build.yaml" ]]; do + source=${source%/*} + done + echo $source +} +# see https://en.wikipedia.org/wiki/Syslog#Severity_level +VIASH_LOGCODE_EMERGENCY=0 +VIASH_LOGCODE_ALERT=1 +VIASH_LOGCODE_CRITICAL=2 +VIASH_LOGCODE_ERROR=3 +VIASH_LOGCODE_WARNING=4 +VIASH_LOGCODE_NOTICE=5 +VIASH_LOGCODE_INFO=6 +VIASH_LOGCODE_DEBUG=7 +VIASH_VERBOSITY=$VIASH_LOGCODE_NOTICE + +# ViashLog: Log events depending on the verbosity level +# usage: ViashLog 1 alert Oh no something went wrong! +# $1: required verbosity level +# $2: display tag +# $3+: messages to display +# stdout: Your input, prepended by '[$2] '. +function ViashLog { + local required_level="$1" + local display_tag="$2" + shift 2 + if [ $VIASH_VERBOSITY -ge $required_level ]; then + >&2 echo "[$display_tag]" "$@" + fi +} + +# ViashEmergency: log events when the system is unstable +# usage: ViashEmergency Oh no something went wrong. +# stdout: Your input, prepended by '[emergency] '. +function ViashEmergency { + ViashLog $VIASH_LOGCODE_EMERGENCY emergency "$@" +} + +# ViashAlert: log events when actions must be taken immediately (e.g. corrupted system database) +# usage: ViashAlert Oh no something went wrong. +# stdout: Your input, prepended by '[alert] '. +function ViashAlert { + ViashLog $VIASH_LOGCODE_ALERT alert "$@" +} + +# ViashCritical: log events when a critical condition occurs +# usage: ViashCritical Oh no something went wrong. +# stdout: Your input, prepended by '[critical] '. +function ViashCritical { + ViashLog $VIASH_LOGCODE_CRITICAL critical "$@" +} + +# ViashError: log events when an error condition occurs +# usage: ViashError Oh no something went wrong. +# stdout: Your input, prepended by '[error] '. +function ViashError { + ViashLog $VIASH_LOGCODE_ERROR error "$@" +} + +# ViashWarning: log potentially abnormal events +# usage: ViashWarning Something may have gone wrong. +# stdout: Your input, prepended by '[warning] '. +function ViashWarning { + ViashLog $VIASH_LOGCODE_WARNING warning "$@" +} + +# ViashNotice: log significant but normal events +# usage: ViashNotice This just happened. +# stdout: Your input, prepended by '[notice] '. +function ViashNotice { + ViashLog $VIASH_LOGCODE_NOTICE notice "$@" +} + +# ViashInfo: log normal events +# usage: ViashInfo This just happened. +# stdout: Your input, prepended by '[info] '. +function ViashInfo { + ViashLog $VIASH_LOGCODE_INFO info "$@" +} + +# ViashDebug: log all events, for debugging purposes +# usage: ViashDebug This just happened. +# stdout: Your input, prepended by '[debug] '. +function ViashDebug { + ViashLog $VIASH_LOGCODE_DEBUG debug "$@" +} + +# find source folder of this component +VIASH_META_RESOURCES_DIR=`ViashSourceDir ${BASH_SOURCE[0]}` + +# find the root of the built components & dependencies +VIASH_TARGET_DIR=`ViashFindTargetDir $VIASH_META_RESOURCES_DIR` + +# define meta fields +VIASH_META_NAME="agat_convert_genscan2gff" +VIASH_META_FUNCTIONALITY_NAME="agat_convert_genscan2gff" +VIASH_META_EXECUTABLE="$VIASH_META_RESOURCES_DIR/$VIASH_META_NAME" +VIASH_META_CONFIG="$VIASH_META_RESOURCES_DIR/.config.vsh.yaml" +VIASH_META_TEMP_DIR="$VIASH_TEMP" + + +# ViashHelp: Display helpful explanation about this executable +function ViashHelp { + echo "agat_convert_genscan2gff main" + echo "" + echo "The script takes a GENSCAN file as input, and will translate it in gff" + echo "format. The GENSCAN format is described" + echo "[here](http://genome.crg.es/courses/Bioinformatics2003_genefinding/results/genscan.html)." + echo "" + echo "**Known problem**" + echo "" + echo "You must have submited only DNA sequence, without any header!! Indeed the tool" + echo "expects only DNA" + echo "sequences and does not crash/warn if an header is submited along the" + echo "sequence. e.g If you have an header \">seq\" s-e-q are seen as the 3 first" + echo "nucleotides of the sequence. Then all prediction location are shifted" + echo "accordingly. (checked only on the [online" + echo "version](http://argonaute.mit.edu/GENSCAN.html)." + echo "I don't know if there is the same problem elsewhere.)" + echo "" + echo "Inputs:" + echo " -g, --genscan" + echo " type: file, required parameter, file must exist" + echo " Input genscan bed file that will be converted." + echo "" + echo "Outputs:" + echo " -o, --out, --outfile, --gff, --output" + echo " type: file, required parameter, output, file must exist" + echo " example: output.gff" + echo " Output GFF file. If no output file is specified, the output will be" + echo " written to STDOUT." + echo "" + echo "Arguments:" + echo " --source" + echo " type: string" + echo " example: Stringtie" + echo " The source informs about the tool used to produce the data and is stored" + echo " in 2nd field of a gff file. Example: Stringtie, Maker, Augustus, etc." + echo " [default: data]" + echo "" + echo " --primary_tag" + echo " type: string" + echo " example: gene" + echo " The primary_tag corresponds to the data type and is stored in 3rd field" + echo " of a gff file. Example: gene, mRNA, CDS, etc. [default: gene]" + echo "" + echo " --inflate_type" + echo " type: string" + echo " example: exon" + echo " Feature type (3rd column in gff) created when inflate parameter" + echo " activated [default: exon]." + echo "" + echo " --verbose" + echo " type: boolean_true" + echo " add verbosity" + echo "" + echo " -c, --config" + echo " type: file, file must exist" + echo " example: custom_agat_config.yaml" + echo " AGAT config file. By default AGAT takes the original agat_config.yaml" + echo " shipped with AGAT. The \`--config\` option gives you the possibility to" + echo " use your own AGAT config file (located elsewhere or named differently)." +} + +# initialise variables +VIASH_MODE='run' +VIASH_ENGINE_ID='docker' + +######## Helper functions for setting up Docker images for viash ######## +# expects: ViashDockerBuild + +# ViashDockerInstallationCheck: check whether Docker is installed correctly +# +# examples: +# ViashDockerInstallationCheck +function ViashDockerInstallationCheck { + ViashDebug "Checking whether Docker is installed" + if [ ! command -v docker &> /dev/null ]; then + ViashCritical "Docker doesn't seem to be installed. See 'https://docs.docker.com/get-docker/' for instructions." + exit 1 + fi + + ViashDebug "Checking whether the Docker daemon is running" + local save=$-; set +e + local docker_version=$(docker version --format '{{.Client.APIVersion}}' 2> /dev/null) + local out=$? + [[ $save =~ e ]] && set -e + if [ $out -ne 0 ]; then + ViashCritical "Docker daemon does not seem to be running. Try one of the following:" + ViashCritical "- Try running 'dockerd' in the command line" + ViashCritical "- See https://docs.docker.com/config/daemon/" + exit 1 + fi +} + +# ViashDockerRemoteTagCheck: check whether a Docker image is available +# on a remote. Assumes `docker login` has been performed, if relevant. +# +# $1 : image identifier with format `[registry/]image[:tag]` +# exit code $? : whether or not the image was found +# examples: +# ViashDockerRemoteTagCheck python:latest +# echo $? # returns '0' +# ViashDockerRemoteTagCheck sdaizudceahifu +# echo $? # returns '1' +function ViashDockerRemoteTagCheck { + docker manifest inspect $1 > /dev/null 2> /dev/null +} + +# ViashDockerLocalTagCheck: check whether a Docker image is available locally +# +# $1 : image identifier with format `[registry/]image[:tag]` +# exit code $? : whether or not the image was found +# examples: +# docker pull python:latest +# ViashDockerLocalTagCheck python:latest +# echo $? # returns '0' +# ViashDockerLocalTagCheck sdaizudceahifu +# echo $? # returns '1' +function ViashDockerLocalTagCheck { + [ -n "$(docker images -q $1)" ] +} + +# ViashDockerPull: pull a Docker image +# +# $1 : image identifier with format `[registry/]image[:tag]` +# exit code $? : whether or not the image was found +# examples: +# ViashDockerPull python:latest +# echo $? # returns '0' +# ViashDockerPull sdaizudceahifu +# echo $? # returns '1' +function ViashDockerPull { + ViashNotice "Checking if Docker image is available at '$1'" + if [ $VIASH_VERBOSITY -ge $VIASH_LOGCODE_INFO ]; then + docker pull $1 && return 0 || return 1 + else + local save=$-; set +e + docker pull $1 2> /dev/null > /dev/null + local out=$? + [[ $save =~ e ]] && set -e + if [ $out -ne 0 ]; then + ViashWarning "Could not pull from '$1'. Docker image doesn't exist or is not accessible." + fi + return $out + fi +} + +# ViashDockerPush: push a Docker image +# +# $1 : image identifier with format `[registry/]image[:tag]` +# exit code $? : whether or not the image was found +# examples: +# ViashDockerPush python:latest +# echo $? # returns '0' +# ViashDockerPush sdaizudceahifu +# echo $? # returns '1' +function ViashDockerPush { + ViashNotice "Pushing image to '$1'" + local save=$-; set +e + local out + if [ $VIASH_VERBOSITY -ge $VIASH_LOGCODE_INFO ]; then + docker push $1 + out=$? + else + docker push $1 2> /dev/null > /dev/null + out=$? + fi + [[ $save =~ e ]] && set -e + if [ $out -eq 0 ]; then + ViashNotice "Container '$1' push succeeded." + else + ViashError "Container '$1' push errored. You might not be logged in or have the necessary permissions." + fi + return $out +} + +# ViashDockerPullElseBuild: pull a Docker image, else build it +# +# $1 : image identifier with format `[registry/]image[:tag]` +# ViashDockerBuild : a Bash function which builds a docker image, takes image identifier as argument. +# examples: +# ViashDockerPullElseBuild mynewcomponent +function ViashDockerPullElseBuild { + local save=$-; set +e + ViashDockerPull $1 + local out=$? + [[ $save =~ e ]] && set -e + if [ $out -ne 0 ]; then + ViashDockerBuild $@ + fi +} + +# ViashDockerSetup: create a Docker image, according to specified docker setup strategy +# +# $1 : image identifier with format `[registry/]image[:tag]` +# $2 : docker setup strategy, see DockerSetupStrategy.scala +# examples: +# ViashDockerSetup mynewcomponent alwaysbuild +function ViashDockerSetup { + local image_id="$1" + local setup_strategy="$2" + if [ "$setup_strategy" == "alwaysbuild" -o "$setup_strategy" == "build" -o "$setup_strategy" == "b" ]; then + ViashDockerBuild $image_id --no-cache $(ViashDockerBuildArgs "$engine_id") + elif [ "$setup_strategy" == "alwayspull" -o "$setup_strategy" == "pull" -o "$setup_strategy" == "p" ]; then + ViashDockerPull $image_id + elif [ "$setup_strategy" == "alwayspullelsebuild" -o "$setup_strategy" == "pullelsebuild" ]; then + ViashDockerPullElseBuild $image_id --no-cache $(ViashDockerBuildArgs "$engine_id") + elif [ "$setup_strategy" == "alwayspullelsecachedbuild" -o "$setup_strategy" == "pullelsecachedbuild" ]; then + ViashDockerPullElseBuild $image_id $(ViashDockerBuildArgs "$engine_id") + elif [ "$setup_strategy" == "alwayscachedbuild" -o "$setup_strategy" == "cachedbuild" -o "$setup_strategy" == "cb" ]; then + ViashDockerBuild $image_id $(ViashDockerBuildArgs "$engine_id") + elif [[ "$setup_strategy" =~ ^ifneedbe ]]; then + local save=$-; set +e + ViashDockerLocalTagCheck $image_id + local outCheck=$? + [[ $save =~ e ]] && set -e + if [ $outCheck -eq 0 ]; then + ViashInfo "Image $image_id already exists" + elif [ "$setup_strategy" == "ifneedbebuild" ]; then + ViashDockerBuild $image_id --no-cache $(ViashDockerBuildArgs "$engine_id") + elif [ "$setup_strategy" == "ifneedbecachedbuild" ]; then + ViashDockerBuild $image_id $(ViashDockerBuildArgs "$engine_id") + elif [ "$setup_strategy" == "ifneedbepull" ]; then + ViashDockerPull $image_id + elif [ "$setup_strategy" == "ifneedbepullelsebuild" ]; then + ViashDockerPullElseBuild $image_id --no-cache $(ViashDockerBuildArgs "$engine_id") + elif [ "$setup_strategy" == "ifneedbepullelsecachedbuild" ]; then + ViashDockerPullElseBuild $image_id $(ViashDockerBuildArgs "$engine_id") + else + ViashError "Unrecognised Docker strategy: $setup_strategy" + exit 1 + fi + elif [ "$setup_strategy" == "push" -o "$setup_strategy" == "forcepush" -o "$setup_strategy" == "alwayspush" ]; then + ViashDockerPush "$image_id" + elif [ "$setup_strategy" == "pushifnotpresent" -o "$setup_strategy" == "gentlepush" -o "$setup_strategy" == "maybepush" ]; then + local save=$-; set +e + ViashDockerRemoteTagCheck $image_id + local outCheck=$? + [[ $save =~ e ]] && set -e + if [ $outCheck -eq 0 ]; then + ViashNotice "Container '$image_id' exists, doing nothing." + else + ViashNotice "Container '$image_id' does not yet exist." + ViashDockerPush "$image_id" + fi + elif [ "$setup_strategy" == "donothing" -o "$setup_strategy" == "meh" ]; then + ViashNotice "Skipping setup." + else + ViashError "Unrecognised Docker strategy: $setup_strategy" + exit 1 + fi +} + +# ViashDockerCheckCommands: Check whether a docker container has the required commands +# +# $1 : image identifier with format `[registry/]image[:tag]` +# $@ : commands to verify being present +# examples: +# ViashDockerCheckCommands bash:4.0 bash ps foo +function ViashDockerCheckCommands { + local image_id="$1" + shift 1 + local commands="$@" + local save=$-; set +e + local missing # mark 'missing' as local in advance, otherwise the exit code of the command will be missing and always be '0' + missing=$(docker run --rm --entrypoint=sh "$image_id" -c "for command in $commands; do command -v \$command >/dev/null 2>&1; if [ \$? -ne 0 ]; then echo \$command; exit 1; fi; done") + local outCheck=$? + [[ $save =~ e ]] && set -e + if [ $outCheck -ne 0 ]; then + ViashError "Docker container '$image_id' does not contain command '$missing'." + exit 1 + fi +} + +# ViashDockerBuild: build a docker image +# $1 : image identifier with format `[registry/]image[:tag]` +# $... : additional arguments to pass to docker build +# $VIASH_META_TEMP_DIR : temporary directory to store dockerfile & optional resources in +# $VIASH_META_NAME : name of the component +# $VIASH_META_RESOURCES_DIR : directory containing the resources +# $VIASH_VERBOSITY : verbosity level +# exit code $? : whether or not the image was built successfully +function ViashDockerBuild { + local image_id="$1" + shift 1 + + # create temporary directory to store dockerfile & optional resources in + local tmpdir=$(mktemp -d "$VIASH_META_TEMP_DIR/dockerbuild-$VIASH_META_NAME-XXXXXX") + local dockerfile="$tmpdir/Dockerfile" + function clean_up { + rm -rf "$tmpdir" + } + trap clean_up EXIT + + # store dockerfile and resources + ViashDockerfile "$VIASH_ENGINE_ID" > "$dockerfile" + + # generate the build command + local docker_build_cmd="docker build -t '$image_id' $@ '$VIASH_META_RESOURCES_DIR' -f '$dockerfile'" + + # build the container + ViashNotice "Building container '$image_id' with Dockerfile" + ViashInfo "$docker_build_cmd" + local save=$-; set +e + if [ $VIASH_VERBOSITY -ge $VIASH_LOGCODE_INFO ]; then + eval $docker_build_cmd + else + eval $docker_build_cmd &> "$tmpdir/docker_build.log" + fi + + # check exit code + local out=$? + [[ $save =~ e ]] && set -e + if [ $out -ne 0 ]; then + ViashError "Error occurred while building container '$image_id'" + if [ $VIASH_VERBOSITY -lt $VIASH_LOGCODE_INFO ]; then + ViashError "Transcript: --------------------------------" + cat "$tmpdir/docker_build.log" + ViashError "End of transcript --------------------------" + fi + exit 1 + fi +} + +######## End of helper functions for setting up Docker images for viash ######## + +# ViashDockerFile: print the dockerfile to stdout +# $1 : engine identifier +# return : dockerfile required to run this component +# examples: +# ViashDockerFile +function ViashDockerfile { + local engine_id="$1" + + if [[ "$engine_id" == "docker" ]]; then + cat << 'VIASHDOCKER' +FROM quay.io/biocontainers/agat:1.4.0--pl5321hdfd78af_0 +ENTRYPOINT [] +RUN agat --version | sed 's/AGAT\s\(.*\)/agat: "\1"/' > /var/software_versions.txt + +LABEL org.opencontainers.image.authors="Leïla Paquay" +LABEL org.opencontainers.image.description="Companion container for running component agat agat_convert_genscan2gff" +LABEL org.opencontainers.image.created="2024-09-17T06:47:34Z" +LABEL org.opencontainers.image.source="https://github.com/NBISweden/AGAT" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" +LABEL org.opencontainers.image.version="main" + +VIASHDOCKER + fi +} + +# ViashDockerBuildArgs: return the arguments to pass to docker build +# $1 : engine identifier +# return : arguments to pass to docker build +function ViashDockerBuildArgs { + local engine_id="$1" + + if [[ "$engine_id" == "docker" ]]; then + echo "" + fi +} + +# ViashAbsolutePath: generate absolute path from relative path +# borrowed from https://stackoverflow.com/a/21951256 +# $1 : relative filename +# return : absolute path +# examples: +# ViashAbsolutePath some_file.txt # returns /path/to/some_file.txt +# ViashAbsolutePath /foo/bar/.. # returns /foo +function ViashAbsolutePath { + local thePath + local parr + local outp + local len + if [[ ! "$1" =~ ^/ ]]; then + thePath="$PWD/$1" + else + thePath="$1" + fi + echo "$thePath" | ( + IFS=/ + read -a parr + declare -a outp + for i in "${parr[@]}"; do + case "$i" in + ''|.) continue ;; + ..) + len=${#outp[@]} + if ((len==0)); then + continue + else + unset outp[$((len-1))] + fi + ;; + *) + len=${#outp[@]} + outp[$len]="$i" + ;; + esac + done + echo /"${outp[*]}" + ) +} +# ViashDockerAutodetectMount: auto configuring docker mounts from parameters +# $1 : The parameter value +# returns : New parameter +# $VIASH_DIRECTORY_MOUNTS : Added another parameter to be passed to docker +# $VIASH_DOCKER_AUTOMOUNT_PREFIX : The prefix to be used for the automounts +# examples: +# ViashDockerAutodetectMount /path/to/bar # returns '/viash_automount/path/to/bar' +# ViashDockerAutodetectMountArg /path/to/bar # returns '--volume="/path/to:/viash_automount/path/to"' +function ViashDockerAutodetectMount { + local abs_path=$(ViashAbsolutePath "$1") + local mount_source + local base_name + if [ -d "$abs_path" ]; then + mount_source="$abs_path" + base_name="" + else + mount_source=`dirname "$abs_path"` + base_name=`basename "$abs_path"` + fi + local mount_target="$VIASH_DOCKER_AUTOMOUNT_PREFIX$mount_source" + if [ -z "$base_name" ]; then + echo "$mount_target" + else + echo "$mount_target/$base_name" + fi +} +function ViashDockerAutodetectMountArg { + local abs_path=$(ViashAbsolutePath "$1") + local mount_source + local base_name + if [ -d "$abs_path" ]; then + mount_source="$abs_path" + base_name="" + else + mount_source=`dirname "$abs_path"` + base_name=`basename "$abs_path"` + fi + local mount_target="$VIASH_DOCKER_AUTOMOUNT_PREFIX$mount_source" + ViashDebug "ViashDockerAutodetectMountArg $1 -> $mount_source -> $mount_target" + echo "--volume=\"$mount_source:$mount_target\"" +} +function ViashDockerStripAutomount { + local abs_path=$(ViashAbsolutePath "$1") + echo "${abs_path#$VIASH_DOCKER_AUTOMOUNT_PREFIX}" +} +# initialise variables +VIASH_DIRECTORY_MOUNTS=() + +# configure default docker automount prefix if it is unset +if [ -z "${VIASH_DOCKER_AUTOMOUNT_PREFIX+x}" ]; then + VIASH_DOCKER_AUTOMOUNT_PREFIX="/viash_automount" +fi + +# initialise docker variables +VIASH_DOCKER_RUN_ARGS=(-i --rm) + +# initialise array +VIASH_POSITIONAL_ARGS='' + +while [[ $# -gt 0 ]]; do + case "$1" in + -h|--help) + ViashHelp + exit + ;; + ---v|---verbose) + let "VIASH_VERBOSITY=VIASH_VERBOSITY+1" + shift 1 + ;; + ---verbosity) + VIASH_VERBOSITY="$2" + shift 2 + ;; + ---verbosity=*) + VIASH_VERBOSITY="$(ViashRemoveFlags "$1")" + shift 1 + ;; + --version) + echo "agat_convert_genscan2gff main" + exit + ;; + --genscan) + [ -n "$VIASH_PAR_GENSCAN" ] && ViashError Bad arguments for option \'--genscan\': \'$VIASH_PAR_GENSCAN\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_GENSCAN="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --genscan. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --genscan=*) + [ -n "$VIASH_PAR_GENSCAN" ] && ViashError Bad arguments for option \'--genscan=*\': \'$VIASH_PAR_GENSCAN\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_GENSCAN=$(ViashRemoveFlags "$1") + shift 1 + ;; + -g) + [ -n "$VIASH_PAR_GENSCAN" ] && ViashError Bad arguments for option \'-g\': \'$VIASH_PAR_GENSCAN\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_GENSCAN="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to -g. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --output) + [ -n "$VIASH_PAR_OUTPUT" ] && ViashError Bad arguments for option \'--output\': \'$VIASH_PAR_OUTPUT\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_OUTPUT="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --output. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --output=*) + [ -n "$VIASH_PAR_OUTPUT" ] && ViashError Bad arguments for option \'--output=*\': \'$VIASH_PAR_OUTPUT\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_OUTPUT=$(ViashRemoveFlags "$1") + shift 1 + ;; + -o) + [ -n "$VIASH_PAR_OUTPUT" ] && ViashError Bad arguments for option \'-o\': \'$VIASH_PAR_OUTPUT\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_OUTPUT="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to -o. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --out) + [ -n "$VIASH_PAR_OUTPUT" ] && ViashError Bad arguments for option \'--out\': \'$VIASH_PAR_OUTPUT\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_OUTPUT="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --out. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --outfile) + [ -n "$VIASH_PAR_OUTPUT" ] && ViashError Bad arguments for option \'--outfile\': \'$VIASH_PAR_OUTPUT\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_OUTPUT="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --outfile. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --gff) + [ -n "$VIASH_PAR_OUTPUT" ] && ViashError Bad arguments for option \'--gff\': \'$VIASH_PAR_OUTPUT\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_OUTPUT="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --gff. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --source) + [ -n "$VIASH_PAR_SOURCE" ] && ViashError Bad arguments for option \'--source\': \'$VIASH_PAR_SOURCE\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_SOURCE="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --source. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --source=*) + [ -n "$VIASH_PAR_SOURCE" ] && ViashError Bad arguments for option \'--source=*\': \'$VIASH_PAR_SOURCE\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_SOURCE=$(ViashRemoveFlags "$1") + shift 1 + ;; + --primary_tag) + [ -n "$VIASH_PAR_PRIMARY_TAG" ] && ViashError Bad arguments for option \'--primary_tag\': \'$VIASH_PAR_PRIMARY_TAG\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_PRIMARY_TAG="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --primary_tag. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --primary_tag=*) + [ -n "$VIASH_PAR_PRIMARY_TAG" ] && ViashError Bad arguments for option \'--primary_tag=*\': \'$VIASH_PAR_PRIMARY_TAG\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_PRIMARY_TAG=$(ViashRemoveFlags "$1") + shift 1 + ;; + --inflate_type) + [ -n "$VIASH_PAR_INFLATE_TYPE" ] && ViashError Bad arguments for option \'--inflate_type\': \'$VIASH_PAR_INFLATE_TYPE\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_INFLATE_TYPE="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --inflate_type. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --inflate_type=*) + [ -n "$VIASH_PAR_INFLATE_TYPE" ] && ViashError Bad arguments for option \'--inflate_type=*\': \'$VIASH_PAR_INFLATE_TYPE\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_INFLATE_TYPE=$(ViashRemoveFlags "$1") + shift 1 + ;; + --verbose) + [ -n "$VIASH_PAR_VERBOSE" ] && ViashError Bad arguments for option \'--verbose\': \'$VIASH_PAR_VERBOSE\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_VERBOSE=true + shift 1 + ;; + --config) + [ -n "$VIASH_PAR_CONFIG" ] && ViashError Bad arguments for option \'--config\': \'$VIASH_PAR_CONFIG\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_CONFIG="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to --config. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + --config=*) + [ -n "$VIASH_PAR_CONFIG" ] && ViashError Bad arguments for option \'--config=*\': \'$VIASH_PAR_CONFIG\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_CONFIG=$(ViashRemoveFlags "$1") + shift 1 + ;; + -c) + [ -n "$VIASH_PAR_CONFIG" ] && ViashError Bad arguments for option \'-c\': \'$VIASH_PAR_CONFIG\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_PAR_CONFIG="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to -c. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + ---engine) + VIASH_ENGINE_ID="$2" + shift 2 + ;; + ---engine=*) + VIASH_ENGINE_ID="$(ViashRemoveFlags "$1")" + shift 1 + ;; + ---setup) + VIASH_MODE='setup' + VIASH_SETUP_STRATEGY="$2" + shift 2 + ;; + ---setup=*) + VIASH_MODE='setup' + VIASH_SETUP_STRATEGY="$(ViashRemoveFlags "$1")" + shift 1 + ;; + ---dockerfile) + VIASH_MODE='dockerfile' + shift 1 + ;; + ---docker_run_args) + VIASH_DOCKER_RUN_ARGS+=("$2") + shift 2 + ;; + ---docker_run_args=*) + VIASH_DOCKER_RUN_ARGS+=("$(ViashRemoveFlags "$1")") + shift 1 + ;; + ---docker_image_id) + VIASH_MODE='docker_image_id' + shift 1 + ;; + ---debug) + VIASH_MODE='debug' + shift 1 + ;; + ---cpus) + [ -n "$VIASH_META_CPUS" ] && ViashError Bad arguments for option \'---cpus\': \'$VIASH_META_CPUS\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_META_CPUS="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to ---cpus. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + ---cpus=*) + [ -n "$VIASH_META_CPUS" ] && ViashError Bad arguments for option \'---cpus=*\': \'$VIASH_META_CPUS\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_META_CPUS=$(ViashRemoveFlags "$1") + shift 1 + ;; + ---memory) + [ -n "$VIASH_META_MEMORY" ] && ViashError Bad arguments for option \'---memory\': \'$VIASH_META_MEMORY\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_META_MEMORY="$2" + [ $# -lt 2 ] && ViashError Not enough arguments passed to ---memory. Use "--help" to get more information on the parameters. && exit 1 + shift 2 + ;; + ---memory=*) + [ -n "$VIASH_META_MEMORY" ] && ViashError Bad arguments for option \'---memory=*\': \'$VIASH_META_MEMORY\' \& \'$2\' - you should provide exactly one argument for this option. && exit 1 + VIASH_META_MEMORY=$(ViashRemoveFlags "$1") + shift 1 + ;; + *) # positional arg or unknown option + # since the positional args will be eval'd, can we always quote, instead of using ViashQuote + VIASH_POSITIONAL_ARGS="$VIASH_POSITIONAL_ARGS '$1'" + [[ $1 == -* ]] && ViashWarning $1 looks like a parameter but is not a defined parameter and will instead be treated as a positional argument. Use "--help" to get more information on the parameters. + shift # past argument + ;; + esac +done + +# parse positional parameters +eval set -- $VIASH_POSITIONAL_ARGS + + +if [ "$VIASH_ENGINE_ID" == "native" ] ; then + VIASH_ENGINE_TYPE='native' +elif [ "$VIASH_ENGINE_ID" == "docker" ] ; then + VIASH_ENGINE_TYPE='docker' +else + ViashError "Engine '$VIASH_ENGINE_ID' is not recognized. Options are: docker, native." + exit 1 +fi + +if [[ "$VIASH_ENGINE_TYPE" == "docker" ]]; then + # check if docker is installed properly + ViashDockerInstallationCheck + + # determine docker image id + if [[ "$VIASH_ENGINE_ID" == 'docker' ]]; then + VIASH_DOCKER_IMAGE_ID='images.viash-hub.com/vsh/biobox/agat/agat_convert_genscan2gff:main' + fi + + # print dockerfile + if [ "$VIASH_MODE" == "dockerfile" ]; then + ViashDockerfile "$VIASH_ENGINE_ID" + exit 0 + + elif [ "$VIASH_MODE" == "docker_image_id" ]; then + echo "$VIASH_DOCKER_IMAGE_ID" + exit 0 + + # enter docker container + elif [[ "$VIASH_MODE" == "debug" ]]; then + VIASH_CMD="docker run --entrypoint=bash ${VIASH_DOCKER_RUN_ARGS[@]} -v '$(pwd)':/pwd --workdir /pwd -t $VIASH_DOCKER_IMAGE_ID" + ViashNotice "+ $VIASH_CMD" + eval $VIASH_CMD + exit + + # build docker image + elif [ "$VIASH_MODE" == "setup" ]; then + ViashDockerSetup "$VIASH_DOCKER_IMAGE_ID" "$VIASH_SETUP_STRATEGY" + ViashDockerCheckCommands "$VIASH_DOCKER_IMAGE_ID" 'ps' 'bash' + exit 0 + fi + + # check if docker image exists + ViashDockerSetup "$VIASH_DOCKER_IMAGE_ID" ifneedbepullelsecachedbuild + ViashDockerCheckCommands "$VIASH_DOCKER_IMAGE_ID" 'ps' 'bash' +fi + +# setting computational defaults + +# helper function for parsing memory strings +function ViashMemoryAsBytes { + local memory=`echo "$1" | tr '[:upper:]' '[:lower:]' | tr -d '[:space:]'` + local memory_regex='^([0-9]+)([kmgtp]i?b?|b)$' + if [[ $memory =~ $memory_regex ]]; then + local number=${memory/[^0-9]*/} + local symbol=${memory/*[0-9]/} + + case $symbol in + b) memory_b=$number ;; + kb|k) memory_b=$(( $number * 1000 )) ;; + mb|m) memory_b=$(( $number * 1000 * 1000 )) ;; + gb|g) memory_b=$(( $number * 1000 * 1000 * 1000 )) ;; + tb|t) memory_b=$(( $number * 1000 * 1000 * 1000 * 1000 )) ;; + pb|p) memory_b=$(( $number * 1000 * 1000 * 1000 * 1000 * 1000 )) ;; + kib|ki) memory_b=$(( $number * 1024 )) ;; + mib|mi) memory_b=$(( $number * 1024 * 1024 )) ;; + gib|gi) memory_b=$(( $number * 1024 * 1024 * 1024 )) ;; + tib|ti) memory_b=$(( $number * 1024 * 1024 * 1024 * 1024 )) ;; + pib|pi) memory_b=$(( $number * 1024 * 1024 * 1024 * 1024 * 1024 )) ;; + esac + echo "$memory_b" + fi +} +# compute memory in different units +if [ ! -z ${VIASH_META_MEMORY+x} ]; then + VIASH_META_MEMORY_B=`ViashMemoryAsBytes $VIASH_META_MEMORY` + # do not define other variables if memory_b is an empty string + if [ ! -z "$VIASH_META_MEMORY_B" ]; then + VIASH_META_MEMORY_KB=$(( ($VIASH_META_MEMORY_B+999) / 1000 )) + VIASH_META_MEMORY_MB=$(( ($VIASH_META_MEMORY_KB+999) / 1000 )) + VIASH_META_MEMORY_GB=$(( ($VIASH_META_MEMORY_MB+999) / 1000 )) + VIASH_META_MEMORY_TB=$(( ($VIASH_META_MEMORY_GB+999) / 1000 )) + VIASH_META_MEMORY_PB=$(( ($VIASH_META_MEMORY_TB+999) / 1000 )) + VIASH_META_MEMORY_KIB=$(( ($VIASH_META_MEMORY_B+1023) / 1024 )) + VIASH_META_MEMORY_MIB=$(( ($VIASH_META_MEMORY_KIB+1023) / 1024 )) + VIASH_META_MEMORY_GIB=$(( ($VIASH_META_MEMORY_MIB+1023) / 1024 )) + VIASH_META_MEMORY_TIB=$(( ($VIASH_META_MEMORY_GIB+1023) / 1024 )) + VIASH_META_MEMORY_PIB=$(( ($VIASH_META_MEMORY_TIB+1023) / 1024 )) + else + # unset memory if string is empty + unset $VIASH_META_MEMORY_B + fi +fi +# unset nproc if string is empty +if [ -z "$VIASH_META_CPUS" ]; then + unset $VIASH_META_CPUS +fi + + +# check whether required parameters exist +if [ -z ${VIASH_PAR_GENSCAN+x} ]; then + ViashError '--genscan' is a required argument. Use "--help" to get more information on the parameters. + exit 1 +fi +if [ -z ${VIASH_PAR_OUTPUT+x} ]; then + ViashError '--output' is a required argument. Use "--help" to get more information on the parameters. + exit 1 +fi +if [ -z ${VIASH_META_NAME+x} ]; then + ViashError 'name' is a required argument. Use "--help" to get more information on the parameters. + exit 1 +fi +if [ -z ${VIASH_META_FUNCTIONALITY_NAME+x} ]; then + ViashError 'functionality_name' is a required argument. Use "--help" to get more information on the parameters. + exit 1 +fi +if [ -z ${VIASH_META_RESOURCES_DIR+x} ]; then + ViashError 'resources_dir' is a required argument. Use "--help" to get more information on the parameters. + exit 1 +fi +if [ -z ${VIASH_META_EXECUTABLE+x} ]; then + ViashError 'executable' is a required argument. Use "--help" to get more information on the parameters. + exit 1 +fi +if [ -z ${VIASH_META_CONFIG+x} ]; then + ViashError 'config' is a required argument. Use "--help" to get more information on the parameters. + exit 1 +fi +if [ -z ${VIASH_META_TEMP_DIR+x} ]; then + ViashError 'temp_dir' is a required argument. Use "--help" to get more information on the parameters. + exit 1 +fi + +# filling in defaults +if [ -z ${VIASH_PAR_VERBOSE+x} ]; then + VIASH_PAR_VERBOSE="false" +fi + +# check whether required files exist +if [ ! -z "$VIASH_PAR_GENSCAN" ] && [ ! -e "$VIASH_PAR_GENSCAN" ]; then + ViashError "Input file '$VIASH_PAR_GENSCAN' does not exist." + exit 1 +fi +if [ ! -z "$VIASH_PAR_CONFIG" ] && [ ! -e "$VIASH_PAR_CONFIG" ]; then + ViashError "Input file '$VIASH_PAR_CONFIG' does not exist." + exit 1 +fi + +# check whether parameters values are of the right type +if [[ -n "$VIASH_PAR_VERBOSE" ]]; then + if ! [[ "$VIASH_PAR_VERBOSE" =~ ^(true|True|TRUE|false|False|FALSE|yes|Yes|YES|no|No|NO)$ ]]; then + ViashError '--verbose' has to be a boolean_true. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_CPUS" ]]; then + if ! [[ "$VIASH_META_CPUS" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'cpus' has to be an integer. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_B" ]]; then + if ! [[ "$VIASH_META_MEMORY_B" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_b' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_KB" ]]; then + if ! [[ "$VIASH_META_MEMORY_KB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_kb' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_MB" ]]; then + if ! [[ "$VIASH_META_MEMORY_MB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_mb' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_GB" ]]; then + if ! [[ "$VIASH_META_MEMORY_GB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_gb' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_TB" ]]; then + if ! [[ "$VIASH_META_MEMORY_TB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_tb' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_PB" ]]; then + if ! [[ "$VIASH_META_MEMORY_PB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_pb' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_KIB" ]]; then + if ! [[ "$VIASH_META_MEMORY_KIB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_kib' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_MIB" ]]; then + if ! [[ "$VIASH_META_MEMORY_MIB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_mib' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_GIB" ]]; then + if ! [[ "$VIASH_META_MEMORY_GIB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_gib' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_TIB" ]]; then + if ! [[ "$VIASH_META_MEMORY_TIB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_tib' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi +if [[ -n "$VIASH_META_MEMORY_PIB" ]]; then + if ! [[ "$VIASH_META_MEMORY_PIB" =~ ^[-+]?[0-9]+$ ]]; then + ViashError 'memory_pib' has to be a long. Use "--help" to get more information on the parameters. + exit 1 + fi +fi + +# create parent directories of output files, if so desired +if [ ! -z "$VIASH_PAR_OUTPUT" ] && [ ! -d "$(dirname "$VIASH_PAR_OUTPUT")" ]; then + mkdir -p "$(dirname "$VIASH_PAR_OUTPUT")" +fi + +if [ "$VIASH_ENGINE_ID" == "native" ] ; then + if [ "$VIASH_MODE" == "run" ]; then + VIASH_CMD="bash" + else + ViashError "Engine '$VIASH_ENGINE_ID' does not support mode '$VIASH_MODE'." + exit 1 + fi +fi + +if [[ "$VIASH_ENGINE_TYPE" == "docker" ]]; then + # detect volumes from file arguments + VIASH_CHOWN_VARS=() +if [ ! -z "$VIASH_PAR_GENSCAN" ]; then + VIASH_DIRECTORY_MOUNTS+=( "$(ViashDockerAutodetectMountArg "$VIASH_PAR_GENSCAN")" ) + VIASH_PAR_GENSCAN=$(ViashDockerAutodetectMount "$VIASH_PAR_GENSCAN") +fi +if [ ! -z "$VIASH_PAR_OUTPUT" ]; then + VIASH_DIRECTORY_MOUNTS+=( "$(ViashDockerAutodetectMountArg "$VIASH_PAR_OUTPUT")" ) + VIASH_PAR_OUTPUT=$(ViashDockerAutodetectMount "$VIASH_PAR_OUTPUT") + VIASH_CHOWN_VARS+=( "$VIASH_PAR_OUTPUT" ) +fi +if [ ! -z "$VIASH_PAR_CONFIG" ]; then + VIASH_DIRECTORY_MOUNTS+=( "$(ViashDockerAutodetectMountArg "$VIASH_PAR_CONFIG")" ) + VIASH_PAR_CONFIG=$(ViashDockerAutodetectMount "$VIASH_PAR_CONFIG") +fi +if [ ! -z "$VIASH_META_RESOURCES_DIR" ]; then + VIASH_DIRECTORY_MOUNTS+=( "$(ViashDockerAutodetectMountArg "$VIASH_META_RESOURCES_DIR")" ) + VIASH_META_RESOURCES_DIR=$(ViashDockerAutodetectMount "$VIASH_META_RESOURCES_DIR") +fi +if [ ! -z "$VIASH_META_EXECUTABLE" ]; then + VIASH_DIRECTORY_MOUNTS+=( "$(ViashDockerAutodetectMountArg "$VIASH_META_EXECUTABLE")" ) + VIASH_META_EXECUTABLE=$(ViashDockerAutodetectMount "$VIASH_META_EXECUTABLE") +fi +if [ ! -z "$VIASH_META_CONFIG" ]; then + VIASH_DIRECTORY_MOUNTS+=( "$(ViashDockerAutodetectMountArg "$VIASH_META_CONFIG")" ) + VIASH_META_CONFIG=$(ViashDockerAutodetectMount "$VIASH_META_CONFIG") +fi +if [ ! -z "$VIASH_META_TEMP_DIR" ]; then + VIASH_DIRECTORY_MOUNTS+=( "$(ViashDockerAutodetectMountArg "$VIASH_META_TEMP_DIR")" ) + VIASH_META_TEMP_DIR=$(ViashDockerAutodetectMount "$VIASH_META_TEMP_DIR") +fi + + # get unique mounts + VIASH_UNIQUE_MOUNTS=($(for val in "${VIASH_DIRECTORY_MOUNTS[@]}"; do echo "$val"; done | sort -u)) +fi + +if [[ "$VIASH_ENGINE_TYPE" == "docker" ]]; then + # change file ownership + function ViashPerformChown { + if (( ${#VIASH_CHOWN_VARS[@]} )); then + set +e + VIASH_CMD="docker run --entrypoint=bash --rm ${VIASH_UNIQUE_MOUNTS[@]} $VIASH_DOCKER_IMAGE_ID -c 'chown $(id -u):$(id -g) --silent --recursive ${VIASH_CHOWN_VARS[@]}'" + ViashDebug "+ $VIASH_CMD" + eval $VIASH_CMD + set -e + fi + } + trap ViashPerformChown EXIT +fi + +if [[ "$VIASH_ENGINE_TYPE" == "docker" ]]; then + # helper function for filling in extra docker args + if [ ! -z "$VIASH_META_MEMORY_B" ]; then + VIASH_DOCKER_RUN_ARGS+=("--memory=${VIASH_META_MEMORY_B}") + fi + if [ ! -z "$VIASH_META_CPUS" ]; then + VIASH_DOCKER_RUN_ARGS+=("--cpus=${VIASH_META_CPUS}") + fi +fi + +if [[ "$VIASH_ENGINE_TYPE" == "docker" ]]; then + VIASH_CMD="docker run --entrypoint=bash ${VIASH_DOCKER_RUN_ARGS[@]} ${VIASH_UNIQUE_MOUNTS[@]} $VIASH_DOCKER_IMAGE_ID" +fi + + +# set dependency paths + + +ViashDebug "Running command: $(echo $VIASH_CMD)" +cat << VIASHEOF | eval $VIASH_CMD +set -e +tempscript=\$(mktemp "$VIASH_META_TEMP_DIR/viash-run-agat_convert_genscan2gff-XXXXXX").sh +function clean_up { + rm "\$tempscript" +} +function interrupt { + echo -e "\nCTRL-C Pressed..." + exit 1 +} +trap clean_up EXIT +trap interrupt INT SIGINT +cat > "\$tempscript" << 'VIASHMAIN' +#!/bin/bash + +set -eo pipefail + +## VIASH START +# The following code has been auto-generated by Viash. +$( if [ ! -z ${VIASH_PAR_GENSCAN+x} ]; then echo "${VIASH_PAR_GENSCAN}" | sed "s#'#'\"'\"'#g;s#.*#par_genscan='&'#" ; else echo "# par_genscan="; fi ) +$( if [ ! -z ${VIASH_PAR_OUTPUT+x} ]; then echo "${VIASH_PAR_OUTPUT}" | sed "s#'#'\"'\"'#g;s#.*#par_output='&'#" ; else echo "# par_output="; fi ) +$( if [ ! -z ${VIASH_PAR_SOURCE+x} ]; then echo "${VIASH_PAR_SOURCE}" | sed "s#'#'\"'\"'#g;s#.*#par_source='&'#" ; else echo "# par_source="; fi ) +$( if [ ! -z ${VIASH_PAR_PRIMARY_TAG+x} ]; then echo "${VIASH_PAR_PRIMARY_TAG}" | sed "s#'#'\"'\"'#g;s#.*#par_primary_tag='&'#" ; else echo "# par_primary_tag="; fi ) +$( if [ ! -z ${VIASH_PAR_INFLATE_TYPE+x} ]; then echo "${VIASH_PAR_INFLATE_TYPE}" | sed "s#'#'\"'\"'#g;s#.*#par_inflate_type='&'#" ; else echo "# par_inflate_type="; fi ) +$( if [ ! -z ${VIASH_PAR_VERBOSE+x} ]; then echo "${VIASH_PAR_VERBOSE}" | sed "s#'#'\"'\"'#g;s#.*#par_verbose='&'#" ; else echo "# par_verbose="; fi ) +$( if [ ! -z ${VIASH_PAR_CONFIG+x} ]; then echo "${VIASH_PAR_CONFIG}" | sed "s#'#'\"'\"'#g;s#.*#par_config='&'#" ; else echo "# par_config="; fi ) +$( if [ ! -z ${VIASH_META_NAME+x} ]; then echo "${VIASH_META_NAME}" | sed "s#'#'\"'\"'#g;s#.*#meta_name='&'#" ; else echo "# meta_name="; fi ) +$( if [ ! -z ${VIASH_META_FUNCTIONALITY_NAME+x} ]; then echo "${VIASH_META_FUNCTIONALITY_NAME}" | sed "s#'#'\"'\"'#g;s#.*#meta_functionality_name='&'#" ; else echo "# meta_functionality_name="; fi ) +$( if [ ! -z ${VIASH_META_RESOURCES_DIR+x} ]; then echo "${VIASH_META_RESOURCES_DIR}" | sed "s#'#'\"'\"'#g;s#.*#meta_resources_dir='&'#" ; else echo "# meta_resources_dir="; fi ) +$( if [ ! -z ${VIASH_META_EXECUTABLE+x} ]; then echo "${VIASH_META_EXECUTABLE}" | sed "s#'#'\"'\"'#g;s#.*#meta_executable='&'#" ; else echo "# meta_executable="; fi ) +$( if [ ! -z ${VIASH_META_CONFIG+x} ]; then echo "${VIASH_META_CONFIG}" | sed "s#'#'\"'\"'#g;s#.*#meta_config='&'#" ; else echo "# meta_config="; fi ) +$( if [ ! -z ${VIASH_META_TEMP_DIR+x} ]; then echo "${VIASH_META_TEMP_DIR}" | sed "s#'#'\"'\"'#g;s#.*#meta_temp_dir='&'#" ; else echo "# meta_temp_dir="; fi ) +$( if [ ! -z ${VIASH_META_CPUS+x} ]; then echo "${VIASH_META_CPUS}" | sed "s#'#'\"'\"'#g;s#.*#meta_cpus='&'#" ; else echo "# meta_cpus="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_B+x} ]; then echo "${VIASH_META_MEMORY_B}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_b='&'#" ; else echo "# meta_memory_b="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_KB+x} ]; then echo "${VIASH_META_MEMORY_KB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_kb='&'#" ; else echo "# meta_memory_kb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_MB+x} ]; then echo "${VIASH_META_MEMORY_MB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_mb='&'#" ; else echo "# meta_memory_mb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_GB+x} ]; then echo "${VIASH_META_MEMORY_GB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_gb='&'#" ; else echo "# meta_memory_gb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_TB+x} ]; then echo "${VIASH_META_MEMORY_TB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_tb='&'#" ; else echo "# meta_memory_tb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_PB+x} ]; then echo "${VIASH_META_MEMORY_PB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_pb='&'#" ; else echo "# meta_memory_pb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_KIB+x} ]; then echo "${VIASH_META_MEMORY_KIB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_kib='&'#" ; else echo "# meta_memory_kib="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_MIB+x} ]; then echo "${VIASH_META_MEMORY_MIB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_mib='&'#" ; else echo "# meta_memory_mib="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_GIB+x} ]; then echo "${VIASH_META_MEMORY_GIB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_gib='&'#" ; else echo "# meta_memory_gib="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_TIB+x} ]; then echo "${VIASH_META_MEMORY_TIB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_tib='&'#" ; else echo "# meta_memory_tib="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_PIB+x} ]; then echo "${VIASH_META_MEMORY_PIB}" | sed "s#'#'\"'\"'#g;s#.*#meta_memory_pib='&'#" ; else echo "# meta_memory_pib="; fi ) + +## VIASH END + +# unset flags +[[ "\$par_inflate_off" == "true" ]] && unset par_inflate_off +[[ "\$par_verbose" == "false" ]] && unset par_verbose + +# run agat_convert_genscan2gff +agat_convert_genscan2gff.pl \\ + --genscan "\$par_genscan" \\ + --output "\$par_output" \\ + \${par_source:+--source "\${par_source}"} \\ + \${par_primary_tag:+--primary_tag "\${par_primary_tag}"} \\ + \${par_inflate_off:+--inflate_off} \\ + \${par_inflate_type:+--inflate_type "\${par_inflate_type}"} \\ + \${par_verbose:+--verbose} \\ + \${par_config:+--config "\${par_config}"} +VIASHMAIN +bash "\$tempscript" & +wait "\$!" + +VIASHEOF + + +if [[ "$VIASH_ENGINE_TYPE" == "docker" ]]; then + # strip viash automount from file paths + + if [ ! -z "$VIASH_PAR_GENSCAN" ]; then + VIASH_PAR_GENSCAN=$(ViashDockerStripAutomount "$VIASH_PAR_GENSCAN") + fi + if [ ! -z "$VIASH_PAR_OUTPUT" ]; then + VIASH_PAR_OUTPUT=$(ViashDockerStripAutomount "$VIASH_PAR_OUTPUT") + fi + if [ ! -z "$VIASH_PAR_CONFIG" ]; then + VIASH_PAR_CONFIG=$(ViashDockerStripAutomount "$VIASH_PAR_CONFIG") + fi + if [ ! -z "$VIASH_META_RESOURCES_DIR" ]; then + VIASH_META_RESOURCES_DIR=$(ViashDockerStripAutomount "$VIASH_META_RESOURCES_DIR") + fi + if [ ! -z "$VIASH_META_EXECUTABLE" ]; then + VIASH_META_EXECUTABLE=$(ViashDockerStripAutomount "$VIASH_META_EXECUTABLE") + fi + if [ ! -z "$VIASH_META_CONFIG" ]; then + VIASH_META_CONFIG=$(ViashDockerStripAutomount "$VIASH_META_CONFIG") + fi + if [ ! -z "$VIASH_META_TEMP_DIR" ]; then + VIASH_META_TEMP_DIR=$(ViashDockerStripAutomount "$VIASH_META_TEMP_DIR") + fi +fi + + +# check whether required files exist +if [ ! -z "$VIASH_PAR_OUTPUT" ] && [ ! -e "$VIASH_PAR_OUTPUT" ]; then + ViashError "Output file '$VIASH_PAR_OUTPUT' does not exist." + exit 1 +fi + + +exit 0 diff --git a/target/executable/agat/agat_convert_sp_gff2gtf/.config.vsh.yaml b/target/executable/agat/agat_convert_sp_gff2gtf/.config.vsh.yaml index 1f027506..49aa6e24 100644 --- a/target/executable/agat/agat_convert_sp_gff2gtf/.config.vsh.yaml +++ b/target/executable/agat/agat_convert_sp_gff2gtf/.config.vsh.yaml @@ -227,15 +227,16 @@ build_info: engine: "docker|native" output: "target/executable/agat/agat_convert_sp_gff2gtf" executable: "target/executable/agat/agat_convert_sp_gff2gtf/agat_convert_sp_gff2gtf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/agat/agat_convert_sp_gff2gtf/agat_convert_sp_gff2gtf b/target/executable/agat/agat_convert_sp_gff2gtf/agat_convert_sp_gff2gtf index b5011465..43f970eb 100755 --- a/target/executable/agat/agat_convert_sp_gff2gtf/agat_convert_sp_gff2gtf +++ b/target/executable/agat/agat_convert_sp_gff2gtf/agat_convert_sp_gff2gtf @@ -2,9 +2,9 @@ # agat_convert_sp_gff2gtf main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -519,9 +519,9 @@ RUN agat --version | sed 's/AGAT\s\(.*\)/agat: "\1"/' > /var/software_versions.t LABEL org.opencontainers.image.authors="Leïla Paquay" LABEL org.opencontainers.image.description="Companion container for running component agat agat_convert_sp_gff2gtf" -LABEL org.opencontainers.image.created="2024-09-16T07:55:17Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:34Z" LABEL org.opencontainers.image.source="https://github.com/NBISweden/AGAT" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/agat/agat_convert_sp_gff2tsv/.config.vsh.yaml b/target/executable/agat/agat_convert_sp_gff2tsv/.config.vsh.yaml index 1f94b805..3f8dd2a6 100644 --- a/target/executable/agat/agat_convert_sp_gff2tsv/.config.vsh.yaml +++ b/target/executable/agat/agat_convert_sp_gff2tsv/.config.vsh.yaml @@ -187,15 +187,16 @@ build_info: engine: "docker|native" output: "target/executable/agat/agat_convert_sp_gff2tsv" executable: "target/executable/agat/agat_convert_sp_gff2tsv/agat_convert_sp_gff2tsv" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/agat/agat_convert_sp_gff2tsv/agat_convert_sp_gff2tsv b/target/executable/agat/agat_convert_sp_gff2tsv/agat_convert_sp_gff2tsv index ce6f0f02..4431a8a9 100755 --- a/target/executable/agat/agat_convert_sp_gff2tsv/agat_convert_sp_gff2tsv +++ b/target/executable/agat/agat_convert_sp_gff2tsv/agat_convert_sp_gff2tsv @@ -2,9 +2,9 @@ # agat_convert_sp_gff2tsv main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -484,9 +484,9 @@ RUN agat --version | sed 's/AGAT\s\(.*\)/agat: "\1"/' > /var/software_versions.t LABEL org.opencontainers.image.authors="Leïla Paquay" LABEL org.opencontainers.image.description="Companion container for running component agat agat_convert_sp_gff2tsv" -LABEL org.opencontainers.image.created="2024-09-16T07:55:16Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:33Z" LABEL org.opencontainers.image.source="https://github.com/NBISweden/AGAT" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/agat/agat_convert_sp_gxf2gxf/.config.vsh.yaml b/target/executable/agat/agat_convert_sp_gxf2gxf/.config.vsh.yaml index 3c911082..53194616 100644 --- a/target/executable/agat/agat_convert_sp_gxf2gxf/.config.vsh.yaml +++ b/target/executable/agat/agat_convert_sp_gxf2gxf/.config.vsh.yaml @@ -194,15 +194,16 @@ build_info: engine: "docker|native" output: "target/executable/agat/agat_convert_sp_gxf2gxf" executable: "target/executable/agat/agat_convert_sp_gxf2gxf/agat_convert_sp_gxf2gxf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/agat/agat_convert_sp_gxf2gxf/agat_convert_sp_gxf2gxf b/target/executable/agat/agat_convert_sp_gxf2gxf/agat_convert_sp_gxf2gxf index 09cabd61..ce66a5e3 100755 --- a/target/executable/agat/agat_convert_sp_gxf2gxf/agat_convert_sp_gxf2gxf +++ b/target/executable/agat/agat_convert_sp_gxf2gxf/agat_convert_sp_gxf2gxf @@ -2,9 +2,9 @@ # agat_convert_sp_gxf2gxf main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -493,9 +493,9 @@ RUN agat --version | sed 's/AGAT\s\(.*\)/agat: "\1"/' > /var/software_versions.t LABEL org.opencontainers.image.authors="Leïla Paquay" LABEL org.opencontainers.image.description="Companion container for running component agat agat_convert_sp_gxf2gxf" -LABEL org.opencontainers.image.created="2024-09-16T07:55:16Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:33Z" LABEL org.opencontainers.image.source="https://github.com/NBISweden/AGAT" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/arriba/.config.vsh.yaml b/target/executable/arriba/.config.vsh.yaml index d5d793f4..e92ab503 100644 --- a/target/executable/arriba/.config.vsh.yaml +++ b/target/executable/arriba/.config.vsh.yaml @@ -705,15 +705,16 @@ build_info: engine: "docker|native" output: "target/executable/arriba" executable: "target/executable/arriba/arriba" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/arriba/arriba b/target/executable/arriba/arriba index 7949c1d1..98b427af 100755 --- a/target/executable/arriba/arriba +++ b/target/executable/arriba/arriba @@ -2,9 +2,9 @@ # arriba main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -754,9 +754,9 @@ RUN arriba -h | grep 'Version:' 2>&1 | sed 's/Version:\s\(.*\)/arriba: "\1"/' > LABEL org.opencontainers.image.authors="Robrecht Cannoodt" LABEL org.opencontainers.image.description="Companion container for running component arriba" -LABEL org.opencontainers.image.created="2024-09-16T07:55:19Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:36Z" LABEL org.opencontainers.image.source="https://github.com/suhrig/arriba" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bcftools/bcftools_annotate/.config.vsh.yaml b/target/executable/bcftools/bcftools_annotate/.config.vsh.yaml index 28b25f9a..07faeecb 100644 --- a/target/executable/bcftools/bcftools_annotate/.config.vsh.yaml +++ b/target/executable/bcftools/bcftools_annotate/.config.vsh.yaml @@ -468,15 +468,16 @@ build_info: engine: "docker|native" output: "target/executable/bcftools/bcftools_annotate" executable: "target/executable/bcftools/bcftools_annotate/bcftools_annotate" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bcftools/bcftools_annotate/bcftools_annotate b/target/executable/bcftools/bcftools_annotate/bcftools_annotate index 17b6dab7..72064de2 100755 --- a/target/executable/bcftools/bcftools_annotate/bcftools_annotate +++ b/target/executable/bcftools/bcftools_annotate/bcftools_annotate @@ -2,9 +2,9 @@ # bcftools_annotate main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -650,9 +650,9 @@ RUN echo "bcftools: \"$(bcftools --version | grep 'bcftools' | sed -n 's/^bcftoo LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bcftools bcftools_annotate" -LABEL org.opencontainers.image.created="2024-09-16T07:55:10Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:28Z" LABEL org.opencontainers.image.source="https://github.com/samtools/bcftools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bcftools/bcftools_concat/.config.vsh.yaml b/target/executable/bcftools/bcftools_concat/.config.vsh.yaml index 4ea6ac4b..b853b542 100644 --- a/target/executable/bcftools/bcftools_concat/.config.vsh.yaml +++ b/target/executable/bcftools/bcftools_concat/.config.vsh.yaml @@ -334,15 +334,16 @@ build_info: engine: "docker|native" output: "target/executable/bcftools/bcftools_concat" executable: "target/executable/bcftools/bcftools_concat/bcftools_concat" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bcftools/bcftools_concat/bcftools_concat b/target/executable/bcftools/bcftools_concat/bcftools_concat index 4a09b174..cda63286 100755 --- a/target/executable/bcftools/bcftools_concat/bcftools_concat +++ b/target/executable/bcftools/bcftools_concat/bcftools_concat @@ -2,9 +2,9 @@ # bcftools_concat main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -566,9 +566,9 @@ RUN echo "bcftools: \"$(bcftools --version | grep 'bcftools' | sed -n 's/^bcftoo LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bcftools bcftools_concat" -LABEL org.opencontainers.image.created="2024-09-16T07:55:10Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:28Z" LABEL org.opencontainers.image.source="https://github.com/samtools/bcftools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bcftools/bcftools_norm/.config.vsh.yaml b/target/executable/bcftools/bcftools_norm/.config.vsh.yaml index 7377fac4..88fafb5c 100644 --- a/target/executable/bcftools/bcftools_norm/.config.vsh.yaml +++ b/target/executable/bcftools/bcftools_norm/.config.vsh.yaml @@ -415,15 +415,16 @@ build_info: engine: "docker|native" output: "target/executable/bcftools/bcftools_norm" executable: "target/executable/bcftools/bcftools_norm/bcftools_norm" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bcftools/bcftools_norm/bcftools_norm b/target/executable/bcftools/bcftools_norm/bcftools_norm index 67e96ff0..ca5cc4b6 100755 --- a/target/executable/bcftools/bcftools_norm/bcftools_norm +++ b/target/executable/bcftools/bcftools_norm/bcftools_norm @@ -2,9 +2,9 @@ # bcftools_norm main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -589,9 +589,9 @@ RUN echo "bcftools: \"$(bcftools --version | grep 'bcftools' | sed -n 's/^bcftoo LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bcftools bcftools_norm" -LABEL org.opencontainers.image.created="2024-09-16T07:55:11Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:29Z" LABEL org.opencontainers.image.source="https://github.com/samtools/bcftools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bcftools/bcftools_sort/.config.vsh.yaml b/target/executable/bcftools/bcftools_sort/.config.vsh.yaml index 52a6c600..5cc8ba49 100644 --- a/target/executable/bcftools/bcftools_sort/.config.vsh.yaml +++ b/target/executable/bcftools/bcftools_sort/.config.vsh.yaml @@ -184,15 +184,16 @@ build_info: engine: "docker|native" output: "target/executable/bcftools/bcftools_sort" executable: "target/executable/bcftools/bcftools_sort/bcftools_sort" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bcftools/bcftools_sort/bcftools_sort b/target/executable/bcftools/bcftools_sort/bcftools_sort index 92a254e2..206195ff 100755 --- a/target/executable/bcftools/bcftools_sort/bcftools_sort +++ b/target/executable/bcftools/bcftools_sort/bcftools_sort @@ -2,9 +2,9 @@ # bcftools_sort main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -483,9 +483,9 @@ RUN echo "bcftools: \"$(bcftools --version | grep 'bcftools' | sed -n 's/^bcftoo LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bcftools bcftools_sort" -LABEL org.opencontainers.image.created="2024-09-16T07:55:09Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:27Z" LABEL org.opencontainers.image.source="https://github.com/samtools/bcftools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bcftools/bcftools_stats/.config.vsh.yaml b/target/executable/bcftools/bcftools_stats/.config.vsh.yaml index 3dcfa35f..353a0c9b 100644 --- a/target/executable/bcftools/bcftools_stats/.config.vsh.yaml +++ b/target/executable/bcftools/bcftools_stats/.config.vsh.yaml @@ -457,15 +457,16 @@ build_info: engine: "docker|native" output: "target/executable/bcftools/bcftools_stats" executable: "target/executable/bcftools/bcftools_stats/bcftools_stats" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bcftools/bcftools_stats/bcftools_stats b/target/executable/bcftools/bcftools_stats/bcftools_stats index eca20808..5cb1505b 100755 --- a/target/executable/bcftools/bcftools_stats/bcftools_stats +++ b/target/executable/bcftools/bcftools_stats/bcftools_stats @@ -2,9 +2,9 @@ # bcftools_stats main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -626,9 +626,9 @@ RUN echo "bcftools: \"$(bcftools --version | grep 'bcftools' | sed -n 's/^bcftoo LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bcftools bcftools_stats" -LABEL org.opencontainers.image.created="2024-09-16T07:55:10Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:28Z" LABEL org.opencontainers.image.source="https://github.com/samtools/bcftools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bcl_convert/.config.vsh.yaml b/target/executable/bcl_convert/.config.vsh.yaml index ce3e633e..1c468e1a 100644 --- a/target/executable/bcl_convert/.config.vsh.yaml +++ b/target/executable/bcl_convert/.config.vsh.yaml @@ -417,15 +417,16 @@ build_info: engine: "docker|native" output: "target/executable/bcl_convert" executable: "target/executable/bcl_convert/bcl_convert" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bcl_convert/bcl_convert b/target/executable/bcl_convert/bcl_convert index c198aca1..4de0c625 100755 --- a/target/executable/bcl_convert/bcl_convert +++ b/target/executable/bcl_convert/bcl_convert @@ -2,9 +2,9 @@ # bcl_convert main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -599,9 +599,9 @@ RUN echo "bcl-convert: \"$(bcl-convert -V 2>&1 >/dev/null | sed -n '/Version/ s/ LABEL org.opencontainers.image.authors="Toni Verbeiren, Dorien Roosen" LABEL org.opencontainers.image.description="Companion container for running component bcl_convert" -LABEL org.opencontainers.image.created="2024-09-16T07:55:18Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:35Z" LABEL org.opencontainers.image.source="https://github.com/viash-hub/biobox" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bd_rhapsody/bd_rhapsody_make_reference/.config.vsh.yaml b/target/executable/bd_rhapsody/bd_rhapsody_make_reference/.config.vsh.yaml index fa458cdd..c8e9f61c 100644 --- a/target/executable/bd_rhapsody/bd_rhapsody_make_reference/.config.vsh.yaml +++ b/target/executable/bd_rhapsody/bd_rhapsody_make_reference/.config.vsh.yaml @@ -269,15 +269,16 @@ build_info: engine: "docker|native" output: "target/executable/bd_rhapsody/bd_rhapsody_make_reference" executable: "target/executable/bd_rhapsody/bd_rhapsody_make_reference/bd_rhapsody_make_reference" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bd_rhapsody/bd_rhapsody_make_reference/bd_rhapsody_make_reference b/target/executable/bd_rhapsody/bd_rhapsody_make_reference/bd_rhapsody_make_reference index 0e5dfe78..50687d2a 100755 --- a/target/executable/bd_rhapsody/bd_rhapsody_make_reference/bd_rhapsody_make_reference +++ b/target/executable/bd_rhapsody/bd_rhapsody_make_reference/bd_rhapsody_make_reference @@ -2,9 +2,9 @@ # bd_rhapsody_make_reference main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -549,9 +549,9 @@ RUN echo "bdgenomics/rhapsody: 2.2.1" > /var/software_versions.txt LABEL org.opencontainers.image.authors="Robrecht Cannoodt, Weiwei Schultz" LABEL org.opencontainers.image.description="Companion container for running component bd_rhapsody bd_rhapsody_make_reference" -LABEL org.opencontainers.image.created="2024-09-16T07:55:21Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:38Z" LABEL org.opencontainers.image.source="https://bitbucket.org/CRSwDev/cwl/src/master/v2.2.1/Extra_Utilities/" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_bamtofastq/.config.vsh.yaml b/target/executable/bedtools/bedtools_bamtofastq/.config.vsh.yaml index 653aa3dd..37f43193 100644 --- a/target/executable/bedtools/bedtools_bamtofastq/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_bamtofastq/.config.vsh.yaml @@ -186,15 +186,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_bamtofastq" executable: "target/executable/bedtools/bedtools_bamtofastq/bedtools_bamtofastq" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_bamtofastq/bedtools_bamtofastq b/target/executable/bedtools/bedtools_bamtofastq/bedtools_bamtofastq index 9644e306..83e0b309 100755 --- a/target/executable/bedtools/bedtools_bamtofastq/bedtools_bamtofastq +++ b/target/executable/bedtools/bedtools_bamtofastq/bedtools_bamtofastq @@ -2,9 +2,9 @@ # bedtools_bamtofastq main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -483,9 +483,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_bamtofastq" -LABEL org.opencontainers.image.created="2024-09-16T07:55:02Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:20Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_bed12tobed6/.config.vsh.yaml b/target/executable/bedtools/bedtools_bed12tobed6/.config.vsh.yaml index ac35701d..e297c91b 100644 --- a/target/executable/bedtools/bedtools_bed12tobed6/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_bed12tobed6/.config.vsh.yaml @@ -175,15 +175,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_bed12tobed6" executable: "target/executable/bedtools/bedtools_bed12tobed6/bedtools_bed12tobed6" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_bed12tobed6/bedtools_bed12tobed6 b/target/executable/bedtools/bedtools_bed12tobed6/bedtools_bed12tobed6 index 03f8f26d..0f62ec1e 100755 --- a/target/executable/bedtools/bedtools_bed12tobed6/bedtools_bed12tobed6 +++ b/target/executable/bedtools/bedtools_bed12tobed6/bedtools_bed12tobed6 @@ -2,9 +2,9 @@ # bedtools_bed12tobed6 main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -480,9 +480,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_bed12tobed6" -LABEL org.opencontainers.image.created="2024-09-16T07:55:01Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:19Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_bedtobam/.config.vsh.yaml b/target/executable/bedtools/bedtools_bedtobam/.config.vsh.yaml index 8b2e8f71..745fce4c 100644 --- a/target/executable/bedtools/bedtools_bedtobam/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_bedtobam/.config.vsh.yaml @@ -213,15 +213,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_bedtobam" executable: "target/executable/bedtools/bedtools_bedtobam/bedtools_bedtobam" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_bedtobam/bedtools_bedtobam b/target/executable/bedtools/bedtools_bedtobam/bedtools_bedtobam index 2fe5359f..c4e5ba47 100755 --- a/target/executable/bedtools/bedtools_bedtobam/bedtools_bedtobam +++ b/target/executable/bedtools/bedtools_bedtobam/bedtools_bedtobam @@ -2,9 +2,9 @@ # bedtools_bedtobam main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -496,9 +496,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_bedtobam" -LABEL org.opencontainers.image.created="2024-09-16T07:55:03Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:21Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_genomecov/.config.vsh.yaml b/target/executable/bedtools/bedtools_genomecov/.config.vsh.yaml index 9a5b6bf1..7d418563 100644 --- a/target/executable/bedtools/bedtools_genomecov/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_genomecov/.config.vsh.yaml @@ -336,15 +336,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_genomecov" executable: "target/executable/bedtools/bedtools_genomecov/bedtools_genomecov" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_genomecov/bedtools_genomecov b/target/executable/bedtools/bedtools_genomecov/bedtools_genomecov index 00001af1..791f6225 100755 --- a/target/executable/bedtools/bedtools_genomecov/bedtools_genomecov +++ b/target/executable/bedtools/bedtools_genomecov/bedtools_genomecov @@ -2,9 +2,9 @@ # bedtools_genomecov main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -591,9 +591,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_genomecov" -LABEL org.opencontainers.image.created="2024-09-16T07:55:00Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:19Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_getfasta/.config.vsh.yaml b/target/executable/bedtools/bedtools_getfasta/.config.vsh.yaml index 5335fa50..4f6f78c5 100644 --- a/target/executable/bedtools/bedtools_getfasta/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_getfasta/.config.vsh.yaml @@ -231,15 +231,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_getfasta" executable: "target/executable/bedtools/bedtools_getfasta/bedtools_getfasta" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_getfasta/bedtools_getfasta b/target/executable/bedtools/bedtools_getfasta/bedtools_getfasta index d8f18e9e..cdde421e 100755 --- a/target/executable/bedtools/bedtools_getfasta/bedtools_getfasta +++ b/target/executable/bedtools/bedtools_getfasta/bedtools_getfasta @@ -2,9 +2,9 @@ # bedtools_getfasta main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -526,9 +526,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Dries Schaumont" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_getfasta" -LABEL org.opencontainers.image.created="2024-09-16T07:55:01Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:19Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_groupby/.config.vsh.yaml b/target/executable/bedtools/bedtools_groupby/.config.vsh.yaml index fcf432ca..b99d48f4 100644 --- a/target/executable/bedtools/bedtools_groupby/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_groupby/.config.vsh.yaml @@ -272,15 +272,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_groupby" executable: "target/executable/bedtools/bedtools_groupby/bedtools_groupby" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_groupby/bedtools_groupby b/target/executable/bedtools/bedtools_groupby/bedtools_groupby index 7f7f3329..54ce4db0 100755 --- a/target/executable/bedtools/bedtools_groupby/bedtools_groupby +++ b/target/executable/bedtools/bedtools_groupby/bedtools_groupby @@ -2,9 +2,9 @@ # bedtools_groupby main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -552,9 +552,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_groupby" -LABEL org.opencontainers.image.created="2024-09-16T07:55:02Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:21Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_intersect/.config.vsh.yaml b/target/executable/bedtools/bedtools_intersect/.config.vsh.yaml index 4fa7d59a..baf0f27e 100644 --- a/target/executable/bedtools/bedtools_intersect/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_intersect/.config.vsh.yaml @@ -409,15 +409,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_intersect" executable: "target/executable/bedtools/bedtools_intersect/bedtools_intersect" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_intersect/bedtools_intersect b/target/executable/bedtools/bedtools_intersect/bedtools_intersect index e40fd9b7..c1ec8795 100755 --- a/target/executable/bedtools/bedtools_intersect/bedtools_intersect +++ b/target/executable/bedtools/bedtools_intersect/bedtools_intersect @@ -2,9 +2,9 @@ # bedtools_intersect main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -633,9 +633,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_intersect" -LABEL org.opencontainers.image.created="2024-09-16T07:55:01Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:20Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_links/.config.vsh.yaml b/target/executable/bedtools/bedtools_links/.config.vsh.yaml index 6107009c..4e021633 100644 --- a/target/executable/bedtools/bedtools_links/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_links/.config.vsh.yaml @@ -209,15 +209,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_links" executable: "target/executable/bedtools/bedtools_links/bedtools_links" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_links/bedtools_links b/target/executable/bedtools/bedtools_links/bedtools_links index 059afe3d..62c4f0c6 100755 --- a/target/executable/bedtools/bedtools_links/bedtools_links +++ b/target/executable/bedtools/bedtools_links/bedtools_links @@ -2,9 +2,9 @@ # bedtools_links main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -500,9 +500,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_links" -LABEL org.opencontainers.image.created="2024-09-16T07:55:02Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:20Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_merge/.config.vsh.yaml b/target/executable/bedtools/bedtools_merge/.config.vsh.yaml index e4fc8e31..a2e1171e 100644 --- a/target/executable/bedtools/bedtools_merge/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_merge/.config.vsh.yaml @@ -278,15 +278,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_merge" executable: "target/executable/bedtools/bedtools_merge/bedtools_merge" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_merge/bedtools_merge b/target/executable/bedtools/bedtools_merge/bedtools_merge index 8048473a..5649cb66 100755 --- a/target/executable/bedtools/bedtools_merge/bedtools_merge +++ b/target/executable/bedtools/bedtools_merge/bedtools_merge @@ -2,9 +2,9 @@ # bedtools_merge main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -558,9 +558,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_merge" -LABEL org.opencontainers.image.created="2024-09-16T07:55:00Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:18Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/bedtools/bedtools_sort/.config.vsh.yaml b/target/executable/bedtools/bedtools_sort/.config.vsh.yaml index 33e5a1cb..46e1f3ed 100644 --- a/target/executable/bedtools/bedtools_sort/.config.vsh.yaml +++ b/target/executable/bedtools/bedtools_sort/.config.vsh.yaml @@ -221,15 +221,16 @@ build_info: engine: "docker|native" output: "target/executable/bedtools/bedtools_sort" executable: "target/executable/bedtools/bedtools_sort/bedtools_sort" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/bedtools/bedtools_sort/bedtools_sort b/target/executable/bedtools/bedtools_sort/bedtools_sort index dd5f0978..f869df66 100755 --- a/target/executable/bedtools/bedtools_sort/bedtools_sort +++ b/target/executable/bedtools/bedtools_sort/bedtools_sort @@ -2,9 +2,9 @@ # bedtools_sort main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -509,9 +509,9 @@ RUN echo "bedtools: \"$(bedtools --version | sed -n 's/^bedtools //p')\"" > /var LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component bedtools bedtools_sort" -LABEL org.opencontainers.image.created="2024-09-16T07:55:03Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:21Z" LABEL org.opencontainers.image.source="https://github.com/arq5x/bedtools2" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/busco/busco_download_datasets/.config.vsh.yaml b/target/executable/busco/busco_download_datasets/.config.vsh.yaml index cee3bf8b..5cf40a6f 100644 --- a/target/executable/busco/busco_download_datasets/.config.vsh.yaml +++ b/target/executable/busco/busco_download_datasets/.config.vsh.yaml @@ -157,15 +157,16 @@ build_info: engine: "docker|native" output: "target/executable/busco/busco_download_datasets" executable: "target/executable/busco/busco_download_datasets/busco_download_datasets" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/busco/busco_download_datasets/busco_download_datasets b/target/executable/busco/busco_download_datasets/busco_download_datasets index ac6ed5a3..3aa7e0e0 100755 --- a/target/executable/busco/busco_download_datasets/busco_download_datasets +++ b/target/executable/busco/busco_download_datasets/busco_download_datasets @@ -2,9 +2,9 @@ # busco_download_datasets main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -475,9 +475,9 @@ RUN busco --version | sed 's/BUSCO\s\(.*\)/busco: "\1"/' > /var/software_version LABEL org.opencontainers.image.authors="Dorien Roosen" LABEL org.opencontainers.image.description="Companion container for running component busco busco_download_datasets" -LABEL org.opencontainers.image.created="2024-09-16T07:55:14Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:31Z" LABEL org.opencontainers.image.source="https://gitlab.com/ezlab/busco" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/busco/busco_list_datasets/.config.vsh.yaml b/target/executable/busco/busco_list_datasets/.config.vsh.yaml index b814305f..85ad7345 100644 --- a/target/executable/busco/busco_list_datasets/.config.vsh.yaml +++ b/target/executable/busco/busco_list_datasets/.config.vsh.yaml @@ -144,15 +144,16 @@ build_info: engine: "docker|native" output: "target/executable/busco/busco_list_datasets" executable: "target/executable/busco/busco_list_datasets/busco_list_datasets" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/busco/busco_list_datasets/busco_list_datasets b/target/executable/busco/busco_list_datasets/busco_list_datasets index d2b82cae..03f25b41 100755 --- a/target/executable/busco/busco_list_datasets/busco_list_datasets +++ b/target/executable/busco/busco_list_datasets/busco_list_datasets @@ -2,9 +2,9 @@ # busco_list_datasets main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -465,9 +465,9 @@ RUN busco --version | sed 's/BUSCO\s\(.*\)/busco: "\1"/' > /var/software_version LABEL org.opencontainers.image.authors="Dorien Roosen" LABEL org.opencontainers.image.description="Companion container for running component busco busco_list_datasets" -LABEL org.opencontainers.image.created="2024-09-16T07:55:14Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:32Z" LABEL org.opencontainers.image.source="https://gitlab.com/ezlab/busco" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/busco/busco_run/.config.vsh.yaml b/target/executable/busco/busco_run/.config.vsh.yaml index bbe33175..a6da3cec 100644 --- a/target/executable/busco/busco_run/.config.vsh.yaml +++ b/target/executable/busco/busco_run/.config.vsh.yaml @@ -422,15 +422,16 @@ build_info: engine: "docker|native" output: "target/executable/busco/busco_run" executable: "target/executable/busco/busco_run/busco_run" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/busco/busco_run/busco_run b/target/executable/busco/busco_run/busco_run index dd49f884..0eb575ef 100755 --- a/target/executable/busco/busco_run/busco_run +++ b/target/executable/busco/busco_run/busco_run @@ -2,9 +2,9 @@ # busco_run main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -632,9 +632,9 @@ RUN busco --version | sed 's/BUSCO\s\(.*\)/busco: "\1"/' > /var/software_version LABEL org.opencontainers.image.authors="Dorien Roosen" LABEL org.opencontainers.image.description="Companion container for running component busco busco_run" -LABEL org.opencontainers.image.created="2024-09-16T07:55:14Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:32Z" LABEL org.opencontainers.image.source="https://gitlab.com/ezlab/busco" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/cutadapt/.config.vsh.yaml b/target/executable/cutadapt/.config.vsh.yaml index 839f0ad3..3225281e 100644 --- a/target/executable/cutadapt/.config.vsh.yaml +++ b/target/executable/cutadapt/.config.vsh.yaml @@ -739,15 +739,16 @@ build_info: engine: "docker|native" output: "target/executable/cutadapt" executable: "target/executable/cutadapt/cutadapt" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/cutadapt/cutadapt b/target/executable/cutadapt/cutadapt index b37c5b79..74007213 100755 --- a/target/executable/cutadapt/cutadapt +++ b/target/executable/cutadapt/cutadapt @@ -2,9 +2,9 @@ # cutadapt main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -831,9 +831,9 @@ RUN cutadapt --version | sed 's/\(.*\)/cutadapt: "\1"/' > /var/software_versions LABEL org.opencontainers.image.authors="Toni Verbeiren" LABEL org.opencontainers.image.description="Companion container for running component cutadapt" -LABEL org.opencontainers.image.created="2024-09-16T07:55:20Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:37Z" LABEL org.opencontainers.image.source="https://github.com/marcelm/cutadapt" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/falco/.config.vsh.yaml b/target/executable/falco/.config.vsh.yaml index 73b5a498..019b624b 100644 --- a/target/executable/falco/.config.vsh.yaml +++ b/target/executable/falco/.config.vsh.yaml @@ -316,15 +316,16 @@ build_info: engine: "docker|native" output: "target/executable/falco" executable: "target/executable/falco/falco" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/falco/falco b/target/executable/falco/falco index 370389db..c4f27641 100755 --- a/target/executable/falco/falco +++ b/target/executable/falco/falco @@ -2,9 +2,9 @@ # falco main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -589,9 +589,9 @@ RUN echo "falco: \"$(falco -v | sed -n 's/^falco //p')\"" > /var/software_versio LABEL org.opencontainers.image.authors="Toni Verbeiren" LABEL org.opencontainers.image.description="Companion container for running component falco" -LABEL org.opencontainers.image.created="2024-09-16T07:55:21Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:38Z" LABEL org.opencontainers.image.source="https://github.com/smithlabcode/falco" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/fastp/.config.vsh.yaml b/target/executable/fastp/.config.vsh.yaml index 41e61239..6d6c671b 100644 --- a/target/executable/fastp/.config.vsh.yaml +++ b/target/executable/fastp/.config.vsh.yaml @@ -1082,15 +1082,16 @@ build_info: engine: "docker|native" output: "target/executable/fastp" executable: "target/executable/fastp/fastp" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/fastp/fastp b/target/executable/fastp/fastp index 1b125ffa..27d4d3aa 100755 --- a/target/executable/fastp/fastp +++ b/target/executable/fastp/fastp @@ -2,9 +2,9 @@ # fastp main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -1028,9 +1028,9 @@ RUN fastp --version 2>&1 | sed 's# #: "#;s#$#"#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Robrecht Cannoodt" LABEL org.opencontainers.image.description="Companion container for running component fastp" -LABEL org.opencontainers.image.created="2024-09-16T07:55:17Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:35Z" LABEL org.opencontainers.image.source="https://github.com/OpenGene/fastp" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/fastqc/.config.vsh.yaml b/target/executable/fastqc/.config.vsh.yaml index 4a0cd646..182639d5 100644 --- a/target/executable/fastqc/.config.vsh.yaml +++ b/target/executable/fastqc/.config.vsh.yaml @@ -339,15 +339,16 @@ build_info: engine: "docker|native" output: "target/executable/fastqc" executable: "target/executable/fastqc/fastqc" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/fastqc/fastqc b/target/executable/fastqc/fastqc index 57cdb6fd..8f59a9d2 100755 --- a/target/executable/fastqc/fastqc +++ b/target/executable/fastqc/fastqc @@ -2,9 +2,9 @@ # fastqc main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -601,9 +601,9 @@ RUN echo "fastqc: $(fastqc --version | sed -n 's/^FastQC //p')" > /var/software_ LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component fastqc" -LABEL org.opencontainers.image.created="2024-09-16T07:55:08Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:26Z" LABEL org.opencontainers.image.source="https://github.com/s-andrews/FastQC" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/featurecounts/.config.vsh.yaml b/target/executable/featurecounts/.config.vsh.yaml index 7e11a9a6..6626975a 100644 --- a/target/executable/featurecounts/.config.vsh.yaml +++ b/target/executable/featurecounts/.config.vsh.yaml @@ -644,15 +644,16 @@ build_info: engine: "docker|native" output: "target/executable/featurecounts" executable: "target/executable/featurecounts/featurecounts" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/featurecounts/featurecounts b/target/executable/featurecounts/featurecounts index b84174bd..70167c7a 100755 --- a/target/executable/featurecounts/featurecounts +++ b/target/executable/featurecounts/featurecounts @@ -2,9 +2,9 @@ # featurecounts main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -754,9 +754,9 @@ RUN featureCounts -v 2>&1 | sed 's/featureCounts v\([0-9.]*\)/featureCounts: \1/ LABEL org.opencontainers.image.authors="Sai Nirmayi Yasa" LABEL org.opencontainers.image.description="Companion container for running component featurecounts" -LABEL org.opencontainers.image.created="2024-09-16T07:55:12Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:30Z" LABEL org.opencontainers.image.source="https://github.com/ShiLab-Bioinformatics/subread" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/fq_subsample/.config.vsh.yaml b/target/executable/fq_subsample/.config.vsh.yaml index 99371fab..f75b71cb 100644 --- a/target/executable/fq_subsample/.config.vsh.yaml +++ b/target/executable/fq_subsample/.config.vsh.yaml @@ -189,15 +189,16 @@ build_info: engine: "docker|native" output: "target/executable/fq_subsample" executable: "target/executable/fq_subsample/fq_subsample" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/fq_subsample/fq_subsample b/target/executable/fq_subsample/fq_subsample index eca0a9e1..05440405 100755 --- a/target/executable/fq_subsample/fq_subsample +++ b/target/executable/fq_subsample/fq_subsample @@ -2,9 +2,9 @@ # fq_subsample main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -493,9 +493,9 @@ mv target/release/fq /usr/local/bin/ && \ cd / && rm -rf /fq LABEL org.opencontainers.image.description="Companion container for running component fq_subsample" -LABEL org.opencontainers.image.created="2024-09-16T07:55:07Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:25Z" LABEL org.opencontainers.image.source="https://github.com/stjude-rust-labs/fq" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/gffread/.config.vsh.yaml b/target/executable/gffread/.config.vsh.yaml index 498d61a0..6be1a51c 100644 --- a/target/executable/gffread/.config.vsh.yaml +++ b/target/executable/gffread/.config.vsh.yaml @@ -684,15 +684,16 @@ build_info: engine: "docker|native" output: "target/executable/gffread" executable: "target/executable/gffread/gffread" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/gffread/gffread b/target/executable/gffread/gffread index 55f53174..8d059e6c 100755 --- a/target/executable/gffread/gffread +++ b/target/executable/gffread/gffread @@ -2,9 +2,9 @@ # gffread main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -807,9 +807,9 @@ RUN echo "gffread: \"$(gffread --version 2>&1)\"" > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component gffread" -LABEL org.opencontainers.image.created="2024-09-16T07:54:59Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:18Z" LABEL org.opencontainers.image.source="https://github.com/gpertea/gffread" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/kallisto/kallisto_index/.config.vsh.yaml b/target/executable/kallisto/kallisto_index/.config.vsh.yaml index 123ec38f..be771c60 100644 --- a/target/executable/kallisto/kallisto_index/.config.vsh.yaml +++ b/target/executable/kallisto/kallisto_index/.config.vsh.yaml @@ -217,15 +217,16 @@ build_info: engine: "docker|native" output: "target/executable/kallisto/kallisto_index" executable: "target/executable/kallisto/kallisto_index/kallisto_index" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/kallisto/kallisto_index/kallisto_index b/target/executable/kallisto/kallisto_index/kallisto_index index 52adac77..30c92acf 100755 --- a/target/executable/kallisto/kallisto_index/kallisto_index +++ b/target/executable/kallisto/kallisto_index/kallisto_index @@ -2,9 +2,9 @@ # kallisto_index main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -506,9 +506,9 @@ tar -xzf kallisto_linux-v0.50.1.tar.gz && \ mv kallisto/kallisto /usr/local/bin/ LABEL org.opencontainers.image.description="Companion container for running component kallisto kallisto_index" -LABEL org.opencontainers.image.created="2024-09-16T07:55:15Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:33Z" LABEL org.opencontainers.image.source="https://github.com/pachterlab/kallisto" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/lofreq/lofreq_call/.config.vsh.yaml b/target/executable/lofreq/lofreq_call/.config.vsh.yaml index 3cdd823a..776bb31f 100644 --- a/target/executable/lofreq/lofreq_call/.config.vsh.yaml +++ b/target/executable/lofreq/lofreq_call/.config.vsh.yaml @@ -506,15 +506,16 @@ build_info: engine: "docker|native" output: "target/executable/lofreq/lofreq_call" executable: "target/executable/lofreq/lofreq_call/lofreq_call" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/lofreq/lofreq_call/lofreq_call b/target/executable/lofreq/lofreq_call/lofreq_call index a504abf7..e7fb4203 100755 --- a/target/executable/lofreq/lofreq_call/lofreq_call +++ b/target/executable/lofreq/lofreq_call/lofreq_call @@ -2,9 +2,9 @@ # lofreq_call main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -656,9 +656,9 @@ echo "lofreq: $version" > /var/software_versions.txt LABEL org.opencontainers.image.authors="Kai Waldrant" LABEL org.opencontainers.image.description="Companion container for running component lofreq lofreq_call" -LABEL org.opencontainers.image.created="2024-09-16T07:55:12Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:29Z" LABEL org.opencontainers.image.source="https://github.com/viash-hub/biobox" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/lofreq/lofreq_indelqual/.config.vsh.yaml b/target/executable/lofreq/lofreq_indelqual/.config.vsh.yaml index b8070fbf..ed66ce83 100644 --- a/target/executable/lofreq/lofreq_indelqual/.config.vsh.yaml +++ b/target/executable/lofreq/lofreq_indelqual/.config.vsh.yaml @@ -214,15 +214,16 @@ build_info: engine: "docker|native" output: "target/executable/lofreq/lofreq_indelqual" executable: "target/executable/lofreq/lofreq_indelqual/lofreq_indelqual" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/lofreq/lofreq_indelqual/lofreq_indelqual b/target/executable/lofreq/lofreq_indelqual/lofreq_indelqual index fef13c13..1d88cb64 100755 --- a/target/executable/lofreq/lofreq_indelqual/lofreq_indelqual +++ b/target/executable/lofreq/lofreq_indelqual/lofreq_indelqual @@ -2,9 +2,9 @@ # lofreq_indelqual main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -501,9 +501,9 @@ echo "lofreq: $version" > /var/software_versions.txt LABEL org.opencontainers.image.authors="Kai Waldrant" LABEL org.opencontainers.image.description="Companion container for running component lofreq lofreq_indelqual" -LABEL org.opencontainers.image.created="2024-09-16T07:55:11Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:29Z" LABEL org.opencontainers.image.source="https://github.com/viash-hub/biobox" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/multiqc/.config.vsh.yaml b/target/executable/multiqc/.config.vsh.yaml index 8953b0a5..dd9250d7 100644 --- a/target/executable/multiqc/.config.vsh.yaml +++ b/target/executable/multiqc/.config.vsh.yaml @@ -455,15 +455,16 @@ build_info: engine: "docker|native" output: "target/executable/multiqc" executable: "target/executable/multiqc/multiqc" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/multiqc/multiqc b/target/executable/multiqc/multiqc index e6d79a36..340b5ac7 100755 --- a/target/executable/multiqc/multiqc +++ b/target/executable/multiqc/multiqc @@ -2,9 +2,9 @@ # multiqc main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -637,9 +637,9 @@ RUN multiqc --version | sed 's/multiqc, version\s\(.*\)/multiqc: "\1"/' > /var/s LABEL org.opencontainers.image.authors="Dorien Roosen" LABEL org.opencontainers.image.description="Companion container for running component multiqc" -LABEL org.opencontainers.image.created="2024-09-16T07:55:20Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:38Z" LABEL org.opencontainers.image.source="https://github.com/viash-hub/biobox" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/pear/.config.vsh.yaml b/target/executable/pear/.config.vsh.yaml index 2a4065dc..19e61bf9 100644 --- a/target/executable/pear/.config.vsh.yaml +++ b/target/executable/pear/.config.vsh.yaml @@ -397,15 +397,16 @@ build_info: engine: "docker|native" output: "target/executable/pear" executable: "target/executable/pear/pear" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/pear/pear b/target/executable/pear/pear index 4322cc19..d31afe7e 100755 --- a/target/executable/pear/pear +++ b/target/executable/pear/pear @@ -2,9 +2,9 @@ # pear main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -597,9 +597,9 @@ echo "pear: $version" > /var/software_versions.txt LABEL org.opencontainers.image.authors="Kai Waldrant" LABEL org.opencontainers.image.description="Companion container for running component pear" -LABEL org.opencontainers.image.created="2024-09-16T07:55:03Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:21Z" LABEL org.opencontainers.image.source="https://github.com/tseemann/PEAR" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/qualimap/qualimap_rnaseq/.config.vsh.yaml b/target/executable/qualimap/qualimap_rnaseq/.config.vsh.yaml index f72fbd6b..e2cbf195 100644 --- a/target/executable/qualimap/qualimap_rnaseq/.config.vsh.yaml +++ b/target/executable/qualimap/qualimap_rnaseq/.config.vsh.yaml @@ -263,15 +263,16 @@ build_info: engine: "docker|native" output: "target/executable/qualimap/qualimap_rnaseq" executable: "target/executable/qualimap/qualimap_rnaseq/qualimap_rnaseq" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/qualimap/qualimap_rnaseq/qualimap_rnaseq b/target/executable/qualimap/qualimap_rnaseq/qualimap_rnaseq index 5f752361..b3f1c73d 100755 --- a/target/executable/qualimap/qualimap_rnaseq/qualimap_rnaseq +++ b/target/executable/qualimap/qualimap_rnaseq/qualimap_rnaseq @@ -2,9 +2,9 @@ # qualimap_rnaseq main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -527,9 +527,9 @@ RUN echo QualiMap: $(qualimap 2>&1 | grep QualiMap | sed 's/^.*QualiMap//') > /v LABEL org.opencontainers.image.authors="Dorien Roosen" LABEL org.opencontainers.image.description="Companion container for running component qualimap qualimap_rnaseq" -LABEL org.opencontainers.image.created="2024-09-16T07:55:07Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:25Z" LABEL org.opencontainers.image.source="https://bitbucket.org/kokonech/qualimap/commits/branch/master" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/rsem/rsem_prepare_reference/.config.vsh.yaml b/target/executable/rsem/rsem_prepare_reference/.config.vsh.yaml index e0a3da6b..910af94c 100644 --- a/target/executable/rsem/rsem_prepare_reference/.config.vsh.yaml +++ b/target/executable/rsem/rsem_prepare_reference/.config.vsh.yaml @@ -415,15 +415,16 @@ build_info: engine: "docker|native" output: "target/executable/rsem/rsem_prepare_reference" executable: "target/executable/rsem/rsem_prepare_reference/rsem_prepare_reference" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/rsem/rsem_prepare_reference/rsem_prepare_reference b/target/executable/rsem/rsem_prepare_reference/rsem_prepare_reference index 41028ef6..7c03fd4d 100755 --- a/target/executable/rsem/rsem_prepare_reference/rsem_prepare_reference +++ b/target/executable/rsem/rsem_prepare_reference/rsem_prepare_reference @@ -2,9 +2,9 @@ # rsem_prepare_reference main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -656,9 +656,9 @@ echo "HISAT2: `hisat2 --version | grep -oP 'hisat2-align-s version \K\d+\.\d+\.\ LABEL org.opencontainers.image.authors="Sai Nirmayi Yasa" LABEL org.opencontainers.image.description="Companion container for running component rsem rsem_prepare_reference" -LABEL org.opencontainers.image.created="2024-09-16T07:55:15Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:32Z" LABEL org.opencontainers.image.source="https://github.com/deweylab/RSEM" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/salmon/salmon_index/.config.vsh.yaml b/target/executable/salmon/salmon_index/.config.vsh.yaml index e8e7640d..646d0fe7 100644 --- a/target/executable/salmon/salmon_index/.config.vsh.yaml +++ b/target/executable/salmon/salmon_index/.config.vsh.yaml @@ -276,15 +276,16 @@ build_info: engine: "docker|native" output: "target/executable/salmon/salmon_index" executable: "target/executable/salmon/salmon_index/salmon_index" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/salmon/salmon_index/salmon_index b/target/executable/salmon/salmon_index/salmon_index index 3bc9dc15..8f97c06e 100755 --- a/target/executable/salmon/salmon_index/salmon_index +++ b/target/executable/salmon/salmon_index/salmon_index @@ -2,9 +2,9 @@ # salmon_index main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -546,9 +546,9 @@ RUN salmon index -v 2>&1 | sed 's/salmon \([0-9.]*\)/salmon: \1/' > /var/softwar LABEL org.opencontainers.image.authors="Sai Nirmayi Yasa" LABEL org.opencontainers.image.description="Companion container for running component salmon salmon_index" -LABEL org.opencontainers.image.created="2024-09-16T07:55:19Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:36Z" LABEL org.opencontainers.image.source="https://github.com/COMBINE-lab/salmon" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/salmon/salmon_quant/.config.vsh.yaml b/target/executable/salmon/salmon_quant/.config.vsh.yaml index 524a13da..f1e5ea2d 100644 --- a/target/executable/salmon/salmon_quant/.config.vsh.yaml +++ b/target/executable/salmon/salmon_quant/.config.vsh.yaml @@ -1172,15 +1172,16 @@ build_info: engine: "docker|native" output: "target/executable/salmon/salmon_quant" executable: "target/executable/salmon/salmon_quant/salmon_quant" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/salmon/salmon_quant/salmon_quant b/target/executable/salmon/salmon_quant/salmon_quant index 86f41365..30f106be 100755 --- a/target/executable/salmon/salmon_quant/salmon_quant +++ b/target/executable/salmon/salmon_quant/salmon_quant @@ -2,9 +2,9 @@ # salmon_quant main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -1168,9 +1168,9 @@ RUN salmon index -v 2>&1 | sed 's/salmon \([0-9.]*\)/salmon: \1/' > /var/softwar LABEL org.opencontainers.image.authors="Sai Nirmayi Yasa" LABEL org.opencontainers.image.description="Companion container for running component salmon salmon_quant" -LABEL org.opencontainers.image.created="2024-09-16T07:55:19Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:37Z" LABEL org.opencontainers.image.source="https://github.com/COMBINE-lab/salmon" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_collate/.config.vsh.yaml b/target/executable/samtools/samtools_collate/.config.vsh.yaml index 737bf92b..08c9f60c 100644 --- a/target/executable/samtools/samtools_collate/.config.vsh.yaml +++ b/target/executable/samtools/samtools_collate/.config.vsh.yaml @@ -263,15 +263,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_collate" executable: "target/executable/samtools/samtools_collate/samtools_collate" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_collate/samtools_collate b/target/executable/samtools/samtools_collate/samtools_collate index c1b047cc..5b89120e 100755 --- a/target/executable/samtools/samtools_collate/samtools_collate +++ b/target/executable/samtools/samtools_collate/samtools_collate @@ -2,9 +2,9 @@ # samtools_collate main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -519,9 +519,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_collate" -LABEL org.opencontainers.image.created="2024-09-16T07:55:06Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:24Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_faidx/.config.vsh.yaml b/target/executable/samtools/samtools_faidx/.config.vsh.yaml index d50b1cba..c24ec78b 100644 --- a/target/executable/samtools/samtools_faidx/.config.vsh.yaml +++ b/target/executable/samtools/samtools_faidx/.config.vsh.yaml @@ -242,15 +242,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_faidx" executable: "target/executable/samtools/samtools_faidx/samtools_faidx" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_faidx/samtools_faidx b/target/executable/samtools/samtools_faidx/samtools_faidx index a7370882..fb490c55 100755 --- a/target/executable/samtools/samtools_faidx/samtools_faidx +++ b/target/executable/samtools/samtools_faidx/samtools_faidx @@ -2,9 +2,9 @@ # samtools_faidx main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -512,9 +512,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_faidx" -LABEL org.opencontainers.image.created="2024-09-16T07:55:05Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:23Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_fasta/.config.vsh.yaml b/target/executable/samtools/samtools_fasta/.config.vsh.yaml index 9ccda6f2..58040685 100644 --- a/target/executable/samtools/samtools_fasta/.config.vsh.yaml +++ b/target/executable/samtools/samtools_fasta/.config.vsh.yaml @@ -432,15 +432,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_fasta" executable: "target/executable/samtools/samtools_fasta/samtools_fasta" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_fasta/samtools_fasta b/target/executable/samtools/samtools_fasta/samtools_fasta index d1380d00..07ee8f24 100755 --- a/target/executable/samtools/samtools_fasta/samtools_fasta +++ b/target/executable/samtools/samtools_fasta/samtools_fasta @@ -2,9 +2,9 @@ # samtools_fasta main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -625,9 +625,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_fasta" -LABEL org.opencontainers.image.created="2024-09-16T07:55:06Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:24Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_fastq/.config.vsh.yaml b/target/executable/samtools/samtools_fastq/.config.vsh.yaml index 9daccb84..700adfa4 100644 --- a/target/executable/samtools/samtools_fastq/.config.vsh.yaml +++ b/target/executable/samtools/samtools_fastq/.config.vsh.yaml @@ -432,15 +432,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_fastq" executable: "target/executable/samtools/samtools_fastq/samtools_fastq" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_fastq/samtools_fastq b/target/executable/samtools/samtools_fastq/samtools_fastq index 4fadf20e..34eaa7bd 100755 --- a/target/executable/samtools/samtools_fastq/samtools_fastq +++ b/target/executable/samtools/samtools_fastq/samtools_fastq @@ -2,9 +2,9 @@ # samtools_fastq main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -626,9 +626,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_fastq" -LABEL org.opencontainers.image.created="2024-09-16T07:55:05Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:23Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_flagstat/.config.vsh.yaml b/target/executable/samtools/samtools_flagstat/.config.vsh.yaml index 0fdd8a4f..3a6e8f0f 100644 --- a/target/executable/samtools/samtools_flagstat/.config.vsh.yaml +++ b/target/executable/samtools/samtools_flagstat/.config.vsh.yaml @@ -172,15 +172,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_flagstat" executable: "target/executable/samtools/samtools_flagstat/samtools_flagstat" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_flagstat/samtools_flagstat b/target/executable/samtools/samtools_flagstat/samtools_flagstat index c783c9a2..fa2b3ae6 100755 --- a/target/executable/samtools/samtools_flagstat/samtools_flagstat +++ b/target/executable/samtools/samtools_flagstat/samtools_flagstat @@ -2,9 +2,9 @@ # samtools_flagstat main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -474,9 +474,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_flagstat" -LABEL org.opencontainers.image.created="2024-09-16T07:55:05Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:23Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_idxstats/.config.vsh.yaml b/target/executable/samtools/samtools_idxstats/.config.vsh.yaml index d736d273..f53bc802 100644 --- a/target/executable/samtools/samtools_idxstats/.config.vsh.yaml +++ b/target/executable/samtools/samtools_idxstats/.config.vsh.yaml @@ -182,15 +182,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_idxstats" executable: "target/executable/samtools/samtools_idxstats/samtools_idxstats" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_idxstats/samtools_idxstats b/target/executable/samtools/samtools_idxstats/samtools_idxstats index 3eeafe52..aca60e6c 100755 --- a/target/executable/samtools/samtools_idxstats/samtools_idxstats +++ b/target/executable/samtools/samtools_idxstats/samtools_idxstats @@ -2,9 +2,9 @@ # samtools_idxstats main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -478,9 +478,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_idxstats" -LABEL org.opencontainers.image.created="2024-09-16T07:55:04Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:22Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_index/.config.vsh.yaml b/target/executable/samtools/samtools_index/.config.vsh.yaml index 9ea612d5..99e770f5 100644 --- a/target/executable/samtools/samtools_index/.config.vsh.yaml +++ b/target/executable/samtools/samtools_index/.config.vsh.yaml @@ -188,15 +188,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_index" executable: "target/executable/samtools/samtools_index/samtools_index" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_index/samtools_index b/target/executable/samtools/samtools_index/samtools_index index aa9a96ec..304a3830 100755 --- a/target/executable/samtools/samtools_index/samtools_index +++ b/target/executable/samtools/samtools_index/samtools_index @@ -2,9 +2,9 @@ # samtools_index main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -485,9 +485,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_index" -LABEL org.opencontainers.image.created="2024-09-16T07:55:04Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:22Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_sort/.config.vsh.yaml b/target/executable/samtools/samtools_sort/.config.vsh.yaml index 7b479f33..2b83a475 100644 --- a/target/executable/samtools/samtools_sort/.config.vsh.yaml +++ b/target/executable/samtools/samtools_sort/.config.vsh.yaml @@ -331,15 +331,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_sort" executable: "target/executable/samtools/samtools_sort/samtools_sort" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_sort/samtools_sort b/target/executable/samtools/samtools_sort/samtools_sort index 90695507..9c09b990 100755 --- a/target/executable/samtools/samtools_sort/samtools_sort +++ b/target/executable/samtools/samtools_sort/samtools_sort @@ -2,9 +2,9 @@ # samtools_sort main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -556,9 +556,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_sort" -LABEL org.opencontainers.image.created="2024-09-16T07:55:06Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:24Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_stats/.config.vsh.yaml b/target/executable/samtools/samtools_stats/.config.vsh.yaml index 6dbd4b63..0b69113b 100644 --- a/target/executable/samtools/samtools_stats/.config.vsh.yaml +++ b/target/executable/samtools/samtools_stats/.config.vsh.yaml @@ -400,15 +400,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_stats" executable: "target/executable/samtools/samtools_stats/samtools_stats" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_stats/samtools_stats b/target/executable/samtools/samtools_stats/samtools_stats index f6a2c53b..3194d278 100755 --- a/target/executable/samtools/samtools_stats/samtools_stats +++ b/target/executable/samtools/samtools_stats/samtools_stats @@ -2,9 +2,9 @@ # samtools_stats main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -575,9 +575,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_stats" -LABEL org.opencontainers.image.created="2024-09-16T07:55:07Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:25Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/samtools/samtools_view/.config.vsh.yaml b/target/executable/samtools/samtools_view/.config.vsh.yaml index c91c2541..a0be80bb 100644 --- a/target/executable/samtools/samtools_view/.config.vsh.yaml +++ b/target/executable/samtools/samtools_view/.config.vsh.yaml @@ -664,15 +664,16 @@ build_info: engine: "docker|native" output: "target/executable/samtools/samtools_view" executable: "target/executable/samtools/samtools_view/samtools_view" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/samtools/samtools_view/samtools_view b/target/executable/samtools/samtools_view/samtools_view index 8c3a35b4..81f8b08e 100755 --- a/target/executable/samtools/samtools_view/samtools_view +++ b/target/executable/samtools/samtools_view/samtools_view @@ -2,9 +2,9 @@ # samtools_view main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -825,9 +825,9 @@ sed 's#Using ##;s# \([0-9\.]*\)$#: \1#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component samtools samtools_view" -LABEL org.opencontainers.image.created="2024-09-16T07:55:04Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:22Z" LABEL org.opencontainers.image.source="https://github.com/samtools/samtools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/seqtk/seqtk_sample/.config.vsh.yaml b/target/executable/seqtk/seqtk_sample/.config.vsh.yaml index 4eb973fc..7d6ca8e5 100644 --- a/target/executable/seqtk/seqtk_sample/.config.vsh.yaml +++ b/target/executable/seqtk/seqtk_sample/.config.vsh.yaml @@ -172,15 +172,16 @@ build_info: engine: "docker|native" output: "target/executable/seqtk/seqtk_sample" executable: "target/executable/seqtk/seqtk_sample/seqtk_sample" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/seqtk/seqtk_sample/seqtk_sample b/target/executable/seqtk/seqtk_sample/seqtk_sample index 137d0e02..ff8ce3cd 100755 --- a/target/executable/seqtk/seqtk_sample/seqtk_sample +++ b/target/executable/seqtk/seqtk_sample/seqtk_sample @@ -2,9 +2,9 @@ # seqtk_sample main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -481,9 +481,9 @@ FROM quay.io/biocontainers/seqtk:1.4--he4a0461_2 ENTRYPOINT [] LABEL org.opencontainers.image.authors="Jakub Majercik" LABEL org.opencontainers.image.description="Companion container for running component seqtk seqtk_sample" -LABEL org.opencontainers.image.created="2024-09-16T07:55:22Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:39Z" LABEL org.opencontainers.image.source="https://github.com/lh3/seqtk/tree/v1.4" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/seqtk/seqtk_subseq/.config.vsh.yaml b/target/executable/seqtk/seqtk_subseq/.config.vsh.yaml index d098cdb1..701172fe 100644 --- a/target/executable/seqtk/seqtk_subseq/.config.vsh.yaml +++ b/target/executable/seqtk/seqtk_subseq/.config.vsh.yaml @@ -195,15 +195,16 @@ build_info: engine: "docker|native" output: "target/executable/seqtk/seqtk_subseq" executable: "target/executable/seqtk/seqtk_subseq/seqtk_subseq" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/seqtk/seqtk_subseq/seqtk_subseq b/target/executable/seqtk/seqtk_subseq/seqtk_subseq index a11e6c08..3a889e08 100755 --- a/target/executable/seqtk/seqtk_subseq/seqtk_subseq +++ b/target/executable/seqtk/seqtk_subseq/seqtk_subseq @@ -2,9 +2,9 @@ # seqtk_subseq main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -491,9 +491,9 @@ RUN echo $(echo $(seqtk 2>&1) | sed -n 's/.*\(Version: [^ ]*\).*/\1/p') > /var/s LABEL org.opencontainers.image.authors="Theodoro Gasperin Terra Camargo" LABEL org.opencontainers.image.description="Companion container for running component seqtk seqtk_subseq" -LABEL org.opencontainers.image.created="2024-09-16T07:55:22Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:39Z" LABEL org.opencontainers.image.source="https://github.com/lh3/seqtk/tree/v1.4" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/sortmerna/.config.vsh.yaml b/target/executable/sortmerna/.config.vsh.yaml index 03bd306a..caa419ba 100644 --- a/target/executable/sortmerna/.config.vsh.yaml +++ b/target/executable/sortmerna/.config.vsh.yaml @@ -590,15 +590,16 @@ build_info: engine: "docker|native" output: "target/executable/sortmerna" executable: "target/executable/sortmerna/sortmerna" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/sortmerna/sortmerna b/target/executable/sortmerna/sortmerna index e9d2f2ba..99fe42e3 100755 --- a/target/executable/sortmerna/sortmerna +++ b/target/executable/sortmerna/sortmerna @@ -2,9 +2,9 @@ # sortmerna main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -744,9 +744,9 @@ wget --no-check-certificate https://github.com/sortmerna/sortmerna/releases/down bash sortmerna-4.3.6-Linux.sh --skip-license LABEL org.opencontainers.image.description="Companion container for running component sortmerna" -LABEL org.opencontainers.image.created="2024-09-16T07:55:18Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:36Z" LABEL org.opencontainers.image.source="https://github.com/sortmerna/sortmerna" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/star/star_align_reads/.config.vsh.yaml b/target/executable/star/star_align_reads/.config.vsh.yaml index f649b3c1..bd197b34 100644 --- a/target/executable/star/star_align_reads/.config.vsh.yaml +++ b/target/executable/star/star_align_reads/.config.vsh.yaml @@ -2662,15 +2662,16 @@ build_info: engine: "docker|native" output: "target/executable/star/star_align_reads" executable: "target/executable/star/star_align_reads/star_align_reads" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/star/star_align_reads/star_align_reads b/target/executable/star/star_align_reads/star_align_reads index b4d27085..a1cf95fe 100755 --- a/target/executable/star/star_align_reads/star_align_reads +++ b/target/executable/star/star_align_reads/star_align_reads @@ -2,9 +2,9 @@ # star_align_reads main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -1920,9 +1920,9 @@ RUN STAR --version | sed 's#\(.*\)#star: "\1"#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Angela Oliveira Pisco, Robrecht Cannoodt" LABEL org.opencontainers.image.description="Companion container for running component star star_align_reads" -LABEL org.opencontainers.image.created="2024-09-16T07:55:13Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:30Z" LABEL org.opencontainers.image.source="https://github.com/alexdobin/STAR" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/star/star_genome_generate/.config.vsh.yaml b/target/executable/star/star_genome_generate/.config.vsh.yaml index bb6cc8a6..4d2b5c9b 100644 --- a/target/executable/star/star_genome_generate/.config.vsh.yaml +++ b/target/executable/star/star_genome_generate/.config.vsh.yaml @@ -332,15 +332,16 @@ build_info: engine: "docker|native" output: "target/executable/star/star_genome_generate" executable: "target/executable/star/star_genome_generate/star_genome_generate" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/star/star_genome_generate/star_genome_generate b/target/executable/star/star_genome_generate/star_genome_generate index 88ed8a9d..5b86b61e 100755 --- a/target/executable/star/star_genome_generate/star_genome_generate +++ b/target/executable/star/star_genome_generate/star_genome_generate @@ -2,9 +2,9 @@ # star_genome_generate main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -577,9 +577,9 @@ RUN STAR --version | sed 's#\(.*\)#star: "\1"#' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Sai Nirmayi Yasa" LABEL org.opencontainers.image.description="Companion container for running component star star_genome_generate" -LABEL org.opencontainers.image.created="2024-09-16T07:55:12Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:30Z" LABEL org.opencontainers.image.source="https://github.com/alexdobin/STAR" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/umi_tools/umi_tools_dedup/.config.vsh.yaml b/target/executable/umi_tools/umi_tools_dedup/.config.vsh.yaml index 36fa5499..202a2102 100644 --- a/target/executable/umi_tools/umi_tools_dedup/.config.vsh.yaml +++ b/target/executable/umi_tools/umi_tools_dedup/.config.vsh.yaml @@ -610,15 +610,16 @@ build_info: engine: "docker|native" output: "target/executable/umi_tools/umi_tools_dedup" executable: "target/executable/umi_tools/umi_tools_dedup/umi_tools_dedup" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/umi_tools/umi_tools_dedup/umi_tools_dedup b/target/executable/umi_tools/umi_tools_dedup/umi_tools_dedup index 93a46c99..ffa5083d 100755 --- a/target/executable/umi_tools/umi_tools_dedup/umi_tools_dedup +++ b/target/executable/umi_tools/umi_tools_dedup/umi_tools_dedup @@ -2,9 +2,9 @@ # umi_tools_dedup main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -770,9 +770,9 @@ RUN umi_tools -v | sed 's/ version//g' > /var/software_versions.txt LABEL org.opencontainers.image.authors="Emma Rousseau" LABEL org.opencontainers.image.description="Companion container for running component umi_tools umi_tools_dedup" -LABEL org.opencontainers.image.created="2024-09-16T07:55:09Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:27Z" LABEL org.opencontainers.image.source="https://github.com/CGATOxford/UMI-tools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/umi_tools/umi_tools_extract/.config.vsh.yaml b/target/executable/umi_tools/umi_tools_extract/.config.vsh.yaml index 7d5d1941..48fb5ec8 100644 --- a/target/executable/umi_tools/umi_tools_extract/.config.vsh.yaml +++ b/target/executable/umi_tools/umi_tools_extract/.config.vsh.yaml @@ -448,15 +448,16 @@ build_info: engine: "docker|native" output: "target/executable/umi_tools/umi_tools_extract" executable: "target/executable/umi_tools/umi_tools_extract/umi_tools_extract" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/umi_tools/umi_tools_extract/umi_tools_extract b/target/executable/umi_tools/umi_tools_extract/umi_tools_extract index f7f53fbf..7d0b7bf1 100755 --- a/target/executable/umi_tools/umi_tools_extract/umi_tools_extract +++ b/target/executable/umi_tools/umi_tools_extract/umi_tools_extract @@ -2,9 +2,9 @@ # umi_tools_extract main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -637,9 +637,9 @@ ENTRYPOINT [] RUN umi_tools -v | sed 's/ version//g' > /var/software_versions.txt LABEL org.opencontainers.image.description="Companion container for running component umi_tools umi_tools_extract" -LABEL org.opencontainers.image.created="2024-09-16T07:55:08Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:26Z" LABEL org.opencontainers.image.source="https://github.com/CGATOxford/UMI-tools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/executable/umi_tools/umi_tools_prepareforrsem/.config.vsh.yaml b/target/executable/umi_tools/umi_tools_prepareforrsem/.config.vsh.yaml index 0d2ffaf6..c30301b5 100644 --- a/target/executable/umi_tools/umi_tools_prepareforrsem/.config.vsh.yaml +++ b/target/executable/umi_tools/umi_tools_prepareforrsem/.config.vsh.yaml @@ -255,15 +255,16 @@ build_info: engine: "docker|native" output: "target/executable/umi_tools/umi_tools_prepareforrsem" executable: "target/executable/umi_tools/umi_tools_prepareforrsem/umi_tools_prepareforrsem" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/executable/umi_tools/umi_tools_prepareforrsem/umi_tools_prepareforrsem b/target/executable/umi_tools/umi_tools_prepareforrsem/umi_tools_prepareforrsem index 7aae967c..4c192523 100755 --- a/target/executable/umi_tools/umi_tools_prepareforrsem/umi_tools_prepareforrsem +++ b/target/executable/umi_tools/umi_tools_prepareforrsem/umi_tools_prepareforrsem @@ -2,9 +2,9 @@ # umi_tools_prepareforrsem main # -# This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -# derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -# Data Intuitive. +# This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +# work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +# Intuitive. # # The component may contain files which fall under a different license. The # authors of this component should specify the license in the header of such @@ -519,9 +519,9 @@ ENTRYPOINT [] RUN umi_tools -v | sed 's/ version//g' > /var/software_versions.txt LABEL org.opencontainers.image.description="Companion container for running component umi_tools umi_tools_prepareforrsem" -LABEL org.opencontainers.image.created="2024-09-16T07:55:09Z" +LABEL org.opencontainers.image.created="2024-09-17T06:47:26Z" LABEL org.opencontainers.image.source="https://github.com/CGATOxford/UMI-tools" -LABEL org.opencontainers.image.revision="124d50ce5318b612e4a1e4da1be705523cd6eab7" +LABEL org.opencontainers.image.revision="38f635ad57ef05550bba3a0864c81627f84f5ad2" LABEL org.opencontainers.image.version="main" VIASHDOCKER diff --git a/target/nextflow/agat/agat_convert_bed2gff/.config.vsh.yaml b/target/nextflow/agat/agat_convert_bed2gff/.config.vsh.yaml index 04c41404..40da9ea1 100644 --- a/target/nextflow/agat/agat_convert_bed2gff/.config.vsh.yaml +++ b/target/nextflow/agat/agat_convert_bed2gff/.config.vsh.yaml @@ -234,15 +234,16 @@ build_info: engine: "docker|native" output: "target/nextflow/agat/agat_convert_bed2gff" executable: "target/nextflow/agat/agat_convert_bed2gff/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/agat/agat_convert_bed2gff/main.nf b/target/nextflow/agat/agat_convert_bed2gff/main.nf index 1b861055..459346ea 100644 --- a/target/nextflow/agat/agat_convert_bed2gff/main.nf +++ b/target/nextflow/agat/agat_convert_bed2gff/main.nf @@ -1,8 +1,8 @@ // agat_convert_bed2gff main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3085,15 +3091,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/agat/agat_convert_bed2gff", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3253,7 +3260,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3384,7 +3395,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3392,8 +3404,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3430,6 +3442,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3441,10 +3454,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/agat/agat_convert_embl2gff/.config.vsh.yaml b/target/nextflow/agat/agat_convert_embl2gff/.config.vsh.yaml index a8b8a381..a2b8f2c6 100644 --- a/target/nextflow/agat/agat_convert_embl2gff/.config.vsh.yaml +++ b/target/nextflow/agat/agat_convert_embl2gff/.config.vsh.yaml @@ -224,15 +224,16 @@ build_info: engine: "docker|native" output: "target/nextflow/agat/agat_convert_embl2gff" executable: "target/nextflow/agat/agat_convert_embl2gff/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/agat/agat_convert_embl2gff/main.nf b/target/nextflow/agat/agat_convert_embl2gff/main.nf index b667f097..cc37300f 100644 --- a/target/nextflow/agat/agat_convert_embl2gff/main.nf +++ b/target/nextflow/agat/agat_convert_embl2gff/main.nf @@ -1,8 +1,8 @@ // agat_convert_embl2gff main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3078,15 +3084,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/agat/agat_convert_embl2gff", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3249,7 +3256,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3380,7 +3391,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3388,8 +3400,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3426,6 +3438,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3437,10 +3450,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/agat/agat_convert_genscan2gff/.config.vsh.yaml b/target/nextflow/agat/agat_convert_genscan2gff/.config.vsh.yaml new file mode 100644 index 00000000..481f934b --- /dev/null +++ b/target/nextflow/agat/agat_convert_genscan2gff/.config.vsh.yaml @@ -0,0 +1,257 @@ +name: "agat_convert_genscan2gff" +namespace: "agat" +version: "main" +authors: +- name: "Leïla Paquay" + roles: + - "author" + - "maintainer" + info: + links: + email: "leila@data-intuitive.com" + github: "Leila011" + linkedin: "leilapaquay" + organizations: + - name: "Data Intuitive" + href: "https://www.data-intuitive.com" + role: "Software Developer" +argument_groups: +- name: "Inputs" + arguments: + - type: "file" + name: "--genscan" + alternatives: + - "-g" + description: "Input genscan bed file that will be converted." + info: null + must_exist: true + create_parent: true + required: true + direction: "input" + multiple: false + multiple_sep: ";" +- name: "Outputs" + arguments: + - type: "file" + name: "--output" + alternatives: + - "-o" + - "--out" + - "--outfile" + - "--gff" + description: "Output GFF file. If no output file is specified, the output will\ + \ be written to STDOUT." + info: null + example: + - "output.gff" + must_exist: true + create_parent: true + required: true + direction: "output" + multiple: false + multiple_sep: ";" +- name: "Arguments" + arguments: + - type: "string" + name: "--source" + description: "The source informs about the tool used to produce the data and is\ + \ stored in 2nd field of a gff file. Example: Stringtie, Maker, Augustus, etc.\ + \ [default: data]\n" + info: null + example: + - "Stringtie" + required: false + direction: "input" + multiple: false + multiple_sep: ";" + - type: "string" + name: "--primary_tag" + description: "The primary_tag corresponds to the data type and is stored in 3rd\ + \ field of a gff file. Example: gene, mRNA, CDS, etc. [default: gene]\n" + info: null + example: + - "gene" + required: false + direction: "input" + multiple: false + multiple_sep: ";" + - type: "string" + name: "--inflate_type" + description: "Feature type (3rd column in gff) created when inflate parameter\ + \ activated [default: exon].\n" + info: null + example: + - "exon" + required: false + direction: "input" + multiple: false + multiple_sep: ";" + - type: "boolean_true" + name: "--verbose" + description: "add verbosity" + info: null + direction: "input" + - type: "file" + name: "--config" + alternatives: + - "-c" + description: "AGAT config file. By default AGAT takes the original agat_config.yaml\ + \ shipped with AGAT. The `--config` option gives you the possibility to use\ + \ your own AGAT config file (located elsewhere or named differently).\n" + info: null + example: + - "custom_agat_config.yaml" + must_exist: true + create_parent: true + required: false + direction: "input" + multiple: false + multiple_sep: ";" +resources: +- type: "bash_script" + path: "script.sh" + is_executable: true +description: "The script takes a GENSCAN file as input, and will translate it in gff\n\ + format. The GENSCAN format is described [here](http://genome.crg.es/courses/Bioinformatics2003_genefinding/results/genscan.html).\n\ + \n**Known problem** \n\nYou must have submited only DNA sequence, without any header!!\ + \ Indeed the tool expects only DNA\nsequences and does not crash/warn if an header\ + \ is submited along the\nsequence. e.g If you have an header \">seq\" s-e-q are\ + \ seen as the 3 first\nnucleotides of the sequence. Then all prediction location\ + \ are shifted\naccordingly. (checked only on the [online version](http://argonaute.mit.edu/GENSCAN.html).\ + \ \nI don't know if there is the same problem elsewhere.)\n" +test_resources: +- type: "bash_script" + path: "test.sh" + is_executable: true +- type: "file" + path: "test_data" +info: null +status: "enabled" +requirements: + commands: + - "ps" +keywords: +- "gene annotations" +- "GFF conversion" +- "GENSCAN" +license: "GPL-3.0" +references: + doi: + - "10.5281/zenodo.3552717" +links: + repository: "https://github.com/NBISweden/AGAT" + homepage: "https://github.com/NBISweden/AGAT" + documentation: "https://agat.readthedocs.io/en/latest/tools/agat_convert_genscan2gff.html" + issue_tracker: "https://github.com/NBISweden/AGAT/issues" +runners: +- type: "executable" + id: "executable" + docker_setup_strategy: "ifneedbepullelsecachedbuild" +- type: "nextflow" + id: "nextflow" + directives: + tag: "$id" + auto: + simplifyInput: true + simplifyOutput: false + transcript: false + publish: false + config: + labels: + mem1gb: "memory = 1000000000.B" + mem2gb: "memory = 2000000000.B" + mem5gb: "memory = 5000000000.B" + mem10gb: "memory = 10000000000.B" + mem20gb: "memory = 20000000000.B" + mem50gb: "memory = 50000000000.B" + mem100gb: "memory = 100000000000.B" + mem200gb: "memory = 200000000000.B" + mem500gb: "memory = 500000000000.B" + mem1tb: "memory = 1000000000000.B" + mem2tb: "memory = 2000000000000.B" + mem5tb: "memory = 5000000000000.B" + mem10tb: "memory = 10000000000000.B" + mem20tb: "memory = 20000000000000.B" + mem50tb: "memory = 50000000000000.B" + mem100tb: "memory = 100000000000000.B" + mem200tb: "memory = 200000000000000.B" + mem500tb: "memory = 500000000000000.B" + mem1gib: "memory = 1073741824.B" + mem2gib: "memory = 2147483648.B" + mem4gib: "memory = 4294967296.B" + mem8gib: "memory = 8589934592.B" + mem16gib: "memory = 17179869184.B" + mem32gib: "memory = 34359738368.B" + mem64gib: "memory = 68719476736.B" + mem128gib: "memory = 137438953472.B" + mem256gib: "memory = 274877906944.B" + mem512gib: "memory = 549755813888.B" + mem1tib: "memory = 1099511627776.B" + mem2tib: "memory = 2199023255552.B" + mem4tib: "memory = 4398046511104.B" + mem8tib: "memory = 8796093022208.B" + mem16tib: "memory = 17592186044416.B" + mem32tib: "memory = 35184372088832.B" + mem64tib: "memory = 70368744177664.B" + mem128tib: "memory = 140737488355328.B" + mem256tib: "memory = 281474976710656.B" + mem512tib: "memory = 562949953421312.B" + cpu1: "cpus = 1" + cpu2: "cpus = 2" + cpu5: "cpus = 5" + cpu10: "cpus = 10" + cpu20: "cpus = 20" + cpu50: "cpus = 50" + cpu100: "cpus = 100" + cpu200: "cpus = 200" + cpu500: "cpus = 500" + cpu1000: "cpus = 1000" + debug: false + container: "docker" +engines: +- type: "docker" + id: "docker" + image: "quay.io/biocontainers/agat:1.4.0--pl5321hdfd78af_0" + target_registry: "images.viash-hub.com" + target_tag: "main" + namespace_separator: "/" + setup: + - type: "docker" + run: + - "agat --version | sed 's/AGAT\\s\\(.*\\)/agat: \"\\1\"/' > /var/software_versions.txt\n" + entrypoint: [] + cmd: null +- type: "native" + id: "native" +build_info: + config: "src/agat/agat_convert_genscan2gff/config.vsh.yaml" + runner: "nextflow" + engine: "docker|native" + output: "target/nextflow/agat/agat_convert_genscan2gff" + executable: "target/nextflow/agat/agat_convert_genscan2gff/main.nf" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" +package_config: + name: "biobox" + version: "main" + description: "A collection of bioinformatics tools for working with sequence data.\n" + info: null + viash_version: "0.9.0" + source: "src" + target: "target" + config_mods: + - ".requirements.commands := ['ps']\n" + - ".engines += { type: \"native\" }" + - ".engines[.type == 'docker'].target_registry := 'images.viash-hub.com'" + - ".engines[.type == 'docker'].target_tag := 'main'" + keywords: + - "bioinformatics" + - "modules" + - "sequencing" + license: "MIT" + organization: "vsh" + links: + repository: "https://github.com/viash-hub/biobox" + issue_tracker: "https://github.com/viash-hub/biobox/issues" diff --git a/target/nextflow/agat/agat_convert_genscan2gff/main.nf b/target/nextflow/agat/agat_convert_genscan2gff/main.nf new file mode 100644 index 00000000..1ab4a671 --- /dev/null +++ b/target/nextflow/agat/agat_convert_genscan2gff/main.nf @@ -0,0 +1,3659 @@ +// agat_convert_genscan2gff main +// +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. +// +// The component may contain files which fall under a different license. The +// authors of this component should specify the license in the header of such +// files, or include a separate license file detailing the licenses of all included +// files. +// +// Component authors: +// * Leïla Paquay (author, maintainer) + +//////////////////////////// +// VDSL3 helper functions // +//////////////////////////// + +// helper file: 'src/main/resources/io/viash/runners/nextflow/arguments/_checkArgumentType.nf' +class UnexpectedArgumentTypeException extends Exception { + String errorIdentifier + String stage + String plainName + String expectedClass + String foundClass + + // ${key ? " in module '$key'" : ""}${id ? " id '$id'" : ""} + UnexpectedArgumentTypeException(String errorIdentifier, String stage, String plainName, String expectedClass, String foundClass) { + super("Error${errorIdentifier ? " $errorIdentifier" : ""}:${stage ? " $stage" : "" } argument '${plainName}' has the wrong type. " + + "Expected type: ${expectedClass}. Found type: ${foundClass}") + this.errorIdentifier = errorIdentifier + this.stage = stage + this.plainName = plainName + this.expectedClass = expectedClass + this.foundClass = foundClass + } +} + +/** + * Checks if the given value is of the expected type. If not, an exception is thrown. + * + * @param stage The stage of the argument (input or output) + * @param par The parameter definition + * @param value The value to check + * @param errorIdentifier The identifier to use in the error message + * @return The value, if it is of the expected type + * @throws UnexpectedArgumentTypeException If the value is not of the expected type +*/ +def _checkArgumentType(String stage, Map par, Object value, String errorIdentifier) { + // expectedClass will only be != null if value is not of the expected type + def expectedClass = null + def foundClass = null + + // todo: split if need be + + if (!par.required && value == null) { + expectedClass = null + } else if (par.multiple) { + if (value !instanceof Collection) { + value = [value] + } + + // split strings + value = value.collectMany{ val -> + if (val instanceof String) { + // collect() to ensure that the result is a List and not simply an array + val.split(par.multiple_sep).collect() + } else { + [val] + } + } + + // process globs + if (par.type == "file" && par.direction == "input") { + value = value.collect{ it instanceof String ? file(it, hidden: true) : it }.flatten() + } + + // check types of elements in list + try { + value = value.collect { listVal -> + _checkArgumentType(stage, par + [multiple: false], listVal, errorIdentifier) + } + } catch (UnexpectedArgumentTypeException e) { + expectedClass = "List[${e.expectedClass}]" + foundClass = "List[${e.foundClass}]" + } + } else if (par.type == "string") { + // cast to string if need be + if (value instanceof GString) { + value = value.toString() + } + expectedClass = value instanceof String ? null : "String" + } else if (par.type == "integer") { + // cast to integer if need be + if (value instanceof String) { + try { + value = value.toInteger() + } catch (NumberFormatException e) { + // do nothing + } + } + if (value instanceof java.math.BigInteger) { + value = value.intValue() + } + expectedClass = value instanceof Integer ? null : "Integer" + } else if (par.type == "long") { + // cast to long if need be + if (value instanceof String) { + try { + value = value.toLong() + } catch (NumberFormatException e) { + // do nothing + } + } + if (value instanceof Integer) { + value = value.toLong() + } + expectedClass = value instanceof Long ? null : "Long" + } else if (par.type == "double") { + // cast to double if need be + if (value instanceof String) { + try { + value = value.toDouble() + } catch (NumberFormatException e) { + // do nothing + } + } + if (value instanceof java.math.BigDecimal) { + value = value.doubleValue() + } + if (value instanceof Float) { + value = value.toDouble() + } + expectedClass = value instanceof Double ? null : "Double" + } else if (par.type == "boolean" | par.type == "boolean_true" | par.type == "boolean_false") { + // cast to boolean if need be + if (value instanceof String) { + def valueLower = value.toLowerCase() + if (valueLower == "true") { + value = true + } else if (valueLower == "false") { + value = false + } + } + expectedClass = value instanceof Boolean ? null : "Boolean" + } else if (par.type == "file" && (par.direction == "input" || stage == "output")) { + // cast to path if need be + if (value instanceof String) { + value = file(value, hidden: true) + } + if (value instanceof File) { + value = value.toPath() + } + expectedClass = value instanceof Path ? null : "Path" + } else if (par.type == "file" && stage == "input" && par.direction == "output") { + // cast to string if need be + if (value instanceof GString) { + value = value.toString() + } + expectedClass = value instanceof String ? null : "String" + } else { + // didn't find a match for par.type + expectedClass = par.type + } + + if (expectedClass != null) { + if (foundClass == null) { + foundClass = value.getClass().getName() + } + throw new UnexpectedArgumentTypeException(errorIdentifier, stage, par.plainName, expectedClass, foundClass) + } + + return value +} +// helper file: 'src/main/resources/io/viash/runners/nextflow/arguments/_processInputValues.nf' +Map _processInputValues(Map inputs, Map config, String id, String key) { + if (!workflow.stubRun) { + config.allArguments.each { arg -> + if (arg.required) { + assert inputs.containsKey(arg.plainName) && inputs.get(arg.plainName) != null : + "Error in module '${key}' id '${id}': required input argument '${arg.plainName}' is missing" + } + } + + inputs = inputs.collectEntries { name, value -> + def par = config.allArguments.find { it.plainName == name && (it.direction == "input" || it.type == "file") } + assert par != null : "Error in module '${key}' id '${id}': '${name}' is not a valid input argument" + + value = _checkArgumentType("input", par, value, "in module '$key' id '$id'") + + [ name, value ] + } + } + return inputs +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/arguments/_processOutputValues.nf' +Map _processOutputValues(Map outputs, Map config, String id, String key) { + if (!workflow.stubRun) { + config.allArguments.each { arg -> + if (arg.direction == "output" && arg.required) { + assert outputs.containsKey(arg.plainName) && outputs.get(arg.plainName) != null : + "Error in module '${key}' id '${id}': required output argument '${arg.plainName}' is missing" + } + } + + outputs = outputs.collectEntries { name, value -> + def par = config.allArguments.find { it.plainName == name && it.direction == "output" } + assert par != null : "Error in module '${key}' id '${id}': '${name}' is not a valid output argument" + + value = _checkArgumentType("output", par, value, "in module '$key' id '$id'") + + [ name, value ] + } + } + return outputs +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/IDChecker.nf' +class IDChecker { + final def items = [] as Set + + @groovy.transform.WithWriteLock + boolean observe(String item) { + if (items.contains(item)) { + return false + } else { + items << item + return true + } + } + + @groovy.transform.WithReadLock + boolean contains(String item) { + return items.contains(item) + } + + @groovy.transform.WithReadLock + Set getItems() { + return items.clone() + } +} +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/_checkUniqueIds.nf' + +/** + * Check if the ids are unique across parameter sets + * + * @param parameterSets a list of parameter sets. + */ +private void _checkUniqueIds(List>> parameterSets) { + def ppIds = parameterSets.collect{it[0]} + assert ppIds.size() == ppIds.unique().size() : "All argument sets should have unique ids. Detected ids: $ppIds" +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/_getChild.nf' + +// helper functions for reading params from file // +def _getChild(parent, child) { + if (child.contains("://") || java.nio.file.Paths.get(child).isAbsolute()) { + child + } else { + def parentAbsolute = java.nio.file.Paths.get(parent).toAbsolutePath().toString() + parentAbsolute.replaceAll('/[^/]*$', "/") + child + } +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/_parseParamList.nf' +/** + * Figure out the param list format based on the file extension + * + * @param param_list A String containing the path to the parameter list file. + * + * @return A String containing the format of the parameter list file. + */ +def _paramListGuessFormat(param_list) { + if (param_list !instanceof String) { + "asis" + } else if (param_list.endsWith(".csv")) { + "csv" + } else if (param_list.endsWith(".json") || param_list.endsWith(".jsn")) { + "json" + } else if (param_list.endsWith(".yaml") || param_list.endsWith(".yml")) { + "yaml" + } else { + "yaml_blob" + } +} + + +/** + * Read the param list + * + * @param param_list One of the following: + * - A String containing the path to the parameter list file (csv, json or yaml), + * - A yaml blob of a list of maps (yaml_blob), + * - Or a groovy list of maps (asis). + * @param config A Map of the Viash configuration. + * + * @return A List of Maps containing the parameters. + */ +def _parseParamList(param_list, Map config) { + // first determine format by extension + def paramListFormat = _paramListGuessFormat(param_list) + + def paramListPath = (paramListFormat != "asis" && paramListFormat != "yaml_blob") ? + file(param_list, hidden: true) : + null + + // get the correct parser function for the detected params_list format + def paramSets = [] + if (paramListFormat == "asis") { + paramSets = param_list + } else if (paramListFormat == "yaml_blob") { + paramSets = readYamlBlob(param_list) + } else if (paramListFormat == "yaml") { + paramSets = readYaml(paramListPath) + } else if (paramListFormat == "json") { + paramSets = readJson(paramListPath) + } else if (paramListFormat == "csv") { + paramSets = readCsv(paramListPath) + } else { + error "Format of provided --param_list not recognised.\n" + + "Found: '$paramListFormat'.\n" + + "Expected: a csv file, a json file, a yaml file,\n" + + "a yaml blob or a groovy list of maps." + } + + // data checks + assert paramSets instanceof List: "--param_list should contain a list of maps" + for (value in paramSets) { + assert value instanceof Map: "--param_list should contain a list of maps" + } + + // id is argument + def idIsArgument = config.allArguments.any{it.plainName == "id"} + + // Reformat from List to List> by adding the ID as first element of a Tuple2 + paramSets = paramSets.collect({ data -> + def id = data.id + if (!idIsArgument) { + data = data.findAll{k, v -> k != "id"} + } + [id, data] + }) + + // Split parameters with 'multiple: true' + paramSets = paramSets.collect({ id, data -> + data = _splitParams(data, config) + [id, data] + }) + + // The paths of input files inside a param_list file may have been specified relatively to the + // location of the param_list file. These paths must be made absolute. + if (paramListPath) { + paramSets = paramSets.collect({ id, data -> + def new_data = data.collectEntries{ parName, parValue -> + def par = config.allArguments.find{it.plainName == parName} + if (par && par.type == "file" && par.direction == "input") { + if (parValue instanceof Collection) { + parValue = parValue.collectMany{path -> + def x = _resolveSiblingIfNotAbsolute(path, paramListPath) + x instanceof Collection ? x : [x] + } + } else { + parValue = _resolveSiblingIfNotAbsolute(parValue, paramListPath) + } + } + [parName, parValue] + } + [id, new_data] + }) + } + + return paramSets +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/_splitParams.nf' +/** + * Split parameters for arguments that accept multiple values using their separator + * + * @param paramList A Map containing parameters to split. + * @param config A Map of the Viash configuration. This Map can be generated from the config file + * using the readConfig() function. + * + * @return A Map of parameters where the parameter values have been split into a list using + * their seperator. + */ +Map _splitParams(Map parValues, Map config){ + def parsedParamValues = parValues.collectEntries { parName, parValue -> + def parameterSettings = config.allArguments.find({it.plainName == parName}) + + if (!parameterSettings) { + // if argument is not found, do not alter + return [parName, parValue] + } + if (parameterSettings.multiple) { // Check if parameter can accept multiple values + if (parValue instanceof Collection) { + parValue = parValue.collect{it instanceof String ? it.split(parameterSettings.multiple_sep) : it } + } else if (parValue instanceof String) { + parValue = parValue.split(parameterSettings.multiple_sep) + } else if (parValue == null) { + parValue = [] + } else { + parValue = [ parValue ] + } + parValue = parValue.flatten() + } + // For all parameters check if multiple values are only passed for + // arguments that allow it. Quietly simplify lists of length 1. + if (!parameterSettings.multiple && parValue instanceof Collection) { + assert parValue.size() == 1 : + "Error: argument ${parName} has too many values.\n" + + " Expected amount: 1. Found: ${parValue.size()}" + parValue = parValue[0] + } + [parName, parValue] + } + return parsedParamValues +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/channelFromParams.nf' +/** + * Parse nextflow parameters based on settings defined in a viash config. + * Return a list of parameter sets, each parameter set corresponding to + * an event in a nextflow channel. The output from this function can be used + * with Channel.fromList to create a nextflow channel with Vdsl3 formatted + * events. + * + * This function performs: + * - A filtering of the params which can be found in the config file. + * - Process the params_list argument which allows a user to to initialise + * a Vsdl3 channel with multiple parameter sets. Possible formats are + * csv, json, yaml, or simply a yaml_blob. A csv should have column names + * which correspond to the different arguments of this pipeline. A json or a yaml + * file should be a list of maps, each of which has keys corresponding to the + * arguments of the pipeline. A yaml blob can also be passed directly as a parameter. + * When passing a csv, json or yaml, relative path names are relativized to the + * location of the parameter file. + * - Combine the parameter sets into a vdsl3 Channel. + * + * @param params Input parameters. Can optionaly contain a 'param_list' key that + * provides a list of arguments that can be split up into multiple events + * in the output channel possible formats of param_lists are: a csv file, + * json file, a yaml file or a yaml blob. Each parameters set (event) must + * have a unique ID. + * @param config A Map of the Viash configuration. This Map can be generated from the config file + * using the readConfig() function. + * + * @return A list of parameters with the first element of the event being + * the event ID and the second element containing a map of the parsed parameters. + */ + +private List>> _paramsToParamSets(Map params, Map config){ + // todo: fetch key from run args + def key_ = config.name + + /* parse regular parameters (not in param_list) */ + /*************************************************/ + def globalParams = config.allArguments + .findAll { params.containsKey(it.plainName) } + .collectEntries { [ it.plainName, params[it.plainName] ] } + def globalID = params.get("id", null) + + /* process params_list arguments */ + /*********************************/ + def paramList = params.containsKey("param_list") && params.param_list != null ? + params.param_list : [] + // if (paramList instanceof String) { + // paramList = [paramList] + // } + // def paramSets = paramList.collectMany{ _parseParamList(it, config) } + // TODO: be able to process param_list when it is a list of strings + def paramSets = _parseParamList(paramList, config) + if (paramSets.isEmpty()) { + paramSets = [[null, [:]]] + } + + /* combine arguments into channel */ + /**********************************/ + def processedParams = paramSets.indexed().collect{ index, tup -> + // Process ID + def id = tup[0] ?: globalID + + if (workflow.stubRun && !id) { + // if stub run, explicitly add an id if missing + id = "stub${index}" + } + assert id != null: "Each parameter set should have at least an 'id'" + + // Process params + def parValues = globalParams + tup[1] + // // Remove parameters which are null, if the default is also null + // parValues = parValues.collectEntries{paramName, paramValue -> + // parameterSettings = config.functionality.allArguments.find({it.plainName == paramName}) + // if ( paramValue != null || parameterSettings.get("default", null) != null ) { + // [paramName, paramValue] + // } + // } + parValues = parValues.collectEntries { name, value -> + def par = config.allArguments.find { it.plainName == name && (it.direction == "input" || it.type == "file") } + assert par != null : "Error in module '${key_}' id '${id}': '${name}' is not a valid input argument" + + if (par == null) { + return [:] + } + value = _checkArgumentType("input", par, value, "in module '$key_' id '$id'") + + [ name, value ] + } + + [id, parValues] + } + + // Check if ids (first element of each list) is unique + _checkUniqueIds(processedParams) + return processedParams +} + +/** + * Parse nextflow parameters based on settings defined in a viash config + * and return a nextflow channel. + * + * @param params Input parameters. Can optionaly contain a 'param_list' key that + * provides a list of arguments that can be split up into multiple events + * in the output channel possible formats of param_lists are: a csv file, + * json file, a yaml file or a yaml blob. Each parameters set (event) must + * have a unique ID. + * @param config A Map of the Viash configuration. This Map can be generated from the config file + * using the readConfig() function. + * + * @return A nextflow Channel with events. Events are formatted as a tuple that contains + * first contains the ID of the event and as second element holds a parameter map. + * + * + */ +def channelFromParams(Map params, Map config) { + def processedParams = _paramsToParamSets(params, config) + return Channel.fromList(processedParams) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/checkUniqueIds.nf' +def checkUniqueIds(Map args) { + def stopOnError = args.stopOnError == null ? args.stopOnError : true + + def idChecker = new IDChecker() + + return filter { tup -> + if (!idChecker.observe(tup[0])) { + if (stopOnError) { + error "Duplicate id: ${tup[0]}" + } else { + log.warn "Duplicate id: ${tup[0]}, removing duplicate entry" + return false + } + } + return true + } +} +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/preprocessInputs.nf' +// This helper file will be deprecated soon +preprocessInputsDeprecationWarningPrinted = false + +def preprocessInputsDeprecationWarning() { + if (!preprocessInputsDeprecationWarningPrinted) { + preprocessInputsDeprecationWarningPrinted = true + System.err.println("Warning: preprocessInputs() is deprecated and will be removed in Viash 0.9.0.") + } +} + +/** + * Generate a nextflow Workflow that allows processing a channel of + * Vdsl3 formatted events and apply a Viash config to them: + * - Gather default parameters from the Viash config and make + * sure that they are correctly formatted (see applyConfig method). + * - Format the input parameters (also using the applyConfig method). + * - Apply the default parameter to the input parameters. + * - Do some assertions: + * ~ Check if the event IDs in the channel are unique. + * + * The events in the channel are formatted as tuples, with the + * first element of the tuples being a unique id of the parameter set, + * and the second element containg the the parameters themselves. + * Optional extra elements of the tuples will be passed to the output as is. + * + * @param args A map that must contain a 'config' key that points + * to a parsed config (see readConfig()). Optionally, a + * 'key' key can be provided which can be used to create a unique + * name for the workflow process. + * + * @return A workflow that allows processing a channel of Vdsl3 formatted events + * and apply a Viash config to them. + */ +def preprocessInputs(Map args) { + preprocessInputsDeprecationWarning() + + def config = args.config + assert config instanceof Map : + "Error in preprocessInputs: config must be a map. " + + "Expected class: Map. Found: config.getClass() is ${config.getClass()}" + def key_ = args.key ?: config.name + + // Get different parameter types (used throughout this function) + def defaultArgs = config.allArguments + .findAll { it.containsKey("default") } + .collectEntries { [ it.plainName, it.default ] } + + map { tup -> + def id = tup[0] + def data = tup[1] + def passthrough = tup.drop(2) + + def new_data = (defaultArgs + data).collectEntries { name, value -> + def par = config.allArguments.find { it.plainName == name && (it.direction == "input" || it.type == "file") } + + if (par != null) { + value = _checkArgumentType("input", par, value, "in module '$key_' id '$id'") + } + + [ name, value ] + } + + [ id, new_data ] + passthrough + } +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/runComponents.nf' +/** + * Run a list of components on a stream of data. + * + * @param components: list of Viash VDSL3 modules to run + * @param fromState: a closure, a map or a list of keys to extract from the input data. + * If a closure, it will be called with the id, the data and the component config. + * @param toState: a closure, a map or a list of keys to extract from the output data + * If a closure, it will be called with the id, the output data, the old state and the component config. + * @param filter: filter function to apply to the input. + * It will be called with the id, the data and the component config. + * @param id: id to use for the output data + * If a closure, it will be called with the id, the data and the component config. + * @param auto: auto options to pass to the components + * + * @return: a workflow that runs the components + **/ +def runComponents(Map args) { + log.warn("runComponents is deprecated, use runEach instead") + assert args.components: "runComponents should be passed a list of components to run" + + def components_ = args.components + if (components_ !instanceof List) { + components_ = [ components_ ] + } + assert components_.size() > 0: "pass at least one component to runComponents" + + def fromState_ = args.fromState + def toState_ = args.toState + def filter_ = args.filter + def id_ = args.id + + workflow runComponentsWf { + take: input_ch + main: + + // generate one channel per method + out_chs = components_.collect{ comp_ -> + def comp_config = comp_.config + + def filter_ch = filter_ + ? input_ch | filter{tup -> + filter_(tup[0], tup[1], comp_config) + } + : input_ch + def id_ch = id_ + ? filter_ch | map{tup -> + // def new_id = id_(tup[0], tup[1], comp_config) + def new_id = tup[0] + if (id_ instanceof String) { + new_id = id_ + } else if (id_ instanceof Closure) { + new_id = id_(new_id, tup[1], comp_config) + } + [new_id] + tup.drop(1) + } + : filter_ch + def data_ch = id_ch | map{tup -> + def new_data = tup[1] + if (fromState_ instanceof Map) { + new_data = fromState_.collectEntries{ key0, key1 -> + [key0, new_data[key1]] + } + } else if (fromState_ instanceof List) { + new_data = fromState_.collectEntries{ key -> + [key, new_data[key]] + } + } else if (fromState_ instanceof Closure) { + new_data = fromState_(tup[0], new_data, comp_config) + } + tup.take(1) + [new_data] + tup.drop(1) + } + def out_ch = data_ch + | comp_.run( + auto: (args.auto ?: [:]) + [simplifyInput: false, simplifyOutput: false] + ) + def post_ch = toState_ + ? out_ch | map{tup -> + def output = tup[1] + def old_state = tup[2] + def new_state = null + if (toState_ instanceof Map) { + new_state = old_state + toState_.collectEntries{ key0, key1 -> + [key0, output[key1]] + } + } else if (toState_ instanceof List) { + new_state = old_state + toState_.collectEntries{ key -> + [key, output[key]] + } + } else if (toState_ instanceof Closure) { + new_state = toState_(tup[0], output, old_state, comp_config) + } + [tup[0], new_state] + tup.drop(3) + } + : out_ch + + post_ch + } + + // mix all results + output_ch = + (out_chs.size == 1) + ? out_chs[0] + : out_chs[0].mix(*out_chs.drop(1)) + + emit: output_ch + } + + return runComponentsWf +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/runEach.nf' +/** + * Run a list of components on a stream of data. + * + * @param components: list of Viash VDSL3 modules to run + * @param fromState: a closure, a map or a list of keys to extract from the input data. + * If a closure, it will be called with the id, the data and the component itself. + * @param toState: a closure, a map or a list of keys to extract from the output data + * If a closure, it will be called with the id, the output data, the old state and the component itself. + * @param filter: filter function to apply to the input. + * It will be called with the id, the data and the component itself. + * @param id: id to use for the output data + * If a closure, it will be called with the id, the data and the component itself. + * @param auto: auto options to pass to the components + * + * @return: a workflow that runs the components + **/ +def runEach(Map args) { + assert args.components: "runEach should be passed a list of components to run" + + def components_ = args.components + if (components_ !instanceof List) { + components_ = [ components_ ] + } + assert components_.size() > 0: "pass at least one component to runEach" + + def fromState_ = args.fromState + def toState_ = args.toState + def filter_ = args.filter + def runIf_ = args.runIf + def id_ = args.id + + assert !runIf_ || runIf_ instanceof Closure: "runEach: must pass a Closure to runIf." + + workflow runEachWf { + take: input_ch + main: + + // generate one channel per method + out_chs = components_.collect{ comp_ -> + def filter_ch = filter_ + ? input_ch | filter{tup -> + filter_(tup[0], tup[1], comp_) + } + : input_ch + def id_ch = id_ + ? filter_ch | map{tup -> + def new_id = id_ + if (new_id instanceof Closure) { + new_id = new_id(tup[0], tup[1], comp_) + } + assert new_id instanceof String : "Error in runEach: id should be a String or a Closure that returns a String. Expected: id instanceof String. Found: ${new_id.getClass()}" + [new_id] + tup.drop(1) + } + : filter_ch + def chPassthrough = null + def chRun = null + if (runIf_) { + def idRunIfBranch = id_ch.branch{ tup -> + run: runIf_(tup[0], tup[1], comp_) + passthrough: true + } + chPassthrough = idRunIfBranch.passthrough + chRun = idRunIfBranch.run + } else { + chRun = id_ch + chPassthrough = Channel.empty() + } + def data_ch = chRun | map{tup -> + def new_data = tup[1] + if (fromState_ instanceof Map) { + new_data = fromState_.collectEntries{ key0, key1 -> + [key0, new_data[key1]] + } + } else if (fromState_ instanceof List) { + new_data = fromState_.collectEntries{ key -> + [key, new_data[key]] + } + } else if (fromState_ instanceof Closure) { + new_data = fromState_(tup[0], new_data, comp_) + } + tup.take(1) + [new_data] + tup.drop(1) + } + def out_ch = data_ch + | comp_.run( + auto: (args.auto ?: [:]) + [simplifyInput: false, simplifyOutput: false] + ) + def post_ch = toState_ + ? out_ch | map{tup -> + def output = tup[1] + def old_state = tup[2] + def new_state = null + if (toState_ instanceof Map) { + new_state = old_state + toState_.collectEntries{ key0, key1 -> + [key0, output[key1]] + } + } else if (toState_ instanceof List) { + new_state = old_state + toState_.collectEntries{ key -> + [key, output[key]] + } + } else if (toState_ instanceof Closure) { + new_state = toState_(tup[0], output, old_state, comp_) + } + [tup[0], new_state] + tup.drop(3) + } + : out_ch + + def return_ch = post_ch + | concat(chPassthrough) + + return_ch + } + + // mix all results + output_ch = + (out_chs.size == 1) + ? out_chs[0] + : out_chs[0].mix(*out_chs.drop(1)) + + emit: output_ch + } + + return runEachWf +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/channel/safeJoin.nf' +/** + * Join sourceChannel to targetChannel + * + * This function joins the sourceChannel to the targetChannel. + * However, each id in the targetChannel must be present in the + * sourceChannel. If _meta.join_id exists in the targetChannel, that is + * used as an id instead. If the id doesn't match any id in the sourceChannel, + * an error is thrown. + */ + +def safeJoin(targetChannel, sourceChannel, key) { + def sourceIDs = new IDChecker() + + def sourceCheck = sourceChannel + | map { tup -> + sourceIDs.observe(tup[0]) + tup + } + def targetCheck = targetChannel + | map { tup -> + def id = tup[0] + + if (!sourceIDs.contains(id)) { + error ( + "Error in module '${key}' when merging output with original state.\n" + + " Reason: output with id '${id}' could not be joined with source channel.\n" + + " If the IDs in the output channel differ from the input channel,\n" + + " please set `tup[1]._meta.join_id to the original ID.\n" + + " Original IDs in input channel: ['${sourceIDs.getItems().join("', '")}'].\n" + + " Unexpected ID in the output channel: '${id}'.\n" + + " Example input event: [\"id\", [input: file(...)]],\n" + + " Example output event: [\"newid\", [output: file(...), _meta: [join_id: \"id\"]]]" + ) + } + // TODO: add link to our documentation on how to fix this + + tup + } + + sourceCheck.cross(targetChannel) + | map{ left, right -> + right + left.drop(1) + } +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/config/_processArgument.nf' +def _processArgument(arg) { + arg.multiple = arg.multiple != null ? arg.multiple : false + arg.required = arg.required != null ? arg.required : false + arg.direction = arg.direction != null ? arg.direction : "input" + arg.multiple_sep = arg.multiple_sep != null ? arg.multiple_sep : ";" + arg.plainName = arg.name.replaceAll("^-*", "") + + if (arg.type == "file") { + arg.must_exist = arg.must_exist != null ? arg.must_exist : true + arg.create_parent = arg.create_parent != null ? arg.create_parent : true + } + + // add default values to output files which haven't already got a default + if (arg.type == "file" && arg.direction == "output" && arg.default == null) { + def mult = arg.multiple ? "_*" : "" + def extSearch = "" + if (arg.default != null) { + extSearch = arg.default + } else if (arg.example != null) { + extSearch = arg.example + } + if (extSearch instanceof List) { + extSearch = extSearch[0] + } + def extSearchResult = extSearch.find("\\.[^\\.]+\$") + def ext = extSearchResult != null ? extSearchResult : "" + arg.default = "\$id.\$key.${arg.plainName}${mult}${ext}" + if (arg.multiple) { + arg.default = [arg.default] + } + } + + if (!arg.multiple) { + if (arg.default != null && arg.default instanceof List) { + arg.default = arg.default[0] + } + if (arg.example != null && arg.example instanceof List) { + arg.example = arg.example[0] + } + } + + if (arg.type == "boolean_true") { + arg.default = false + } + if (arg.type == "boolean_false") { + arg.default = true + } + + arg +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/config/addGlobalParams.nf' +def addGlobalArguments(config) { + def localConfig = [ + "argument_groups": [ + [ + "name": "Nextflow input-output arguments", + "description": "Input/output parameters for Nextflow itself. Please note that both publishDir and publish_dir are supported but at least one has to be configured.", + "arguments" : [ + [ + 'name': '--publish_dir', + 'required': true, + 'type': 'string', + 'description': 'Path to an output directory.', + 'example': 'output/', + 'multiple': false + ], + [ + 'name': '--param_list', + 'required': false, + 'type': 'string', + 'description': '''Allows inputting multiple parameter sets to initialise a Nextflow channel. A `param_list` can either be a list of maps, a csv file, a json file, a yaml file, or simply a yaml blob. + | + |* A list of maps (as-is) where the keys of each map corresponds to the arguments of the pipeline. Example: in a `nextflow.config` file: `param_list: [ ['id': 'foo', 'input': 'foo.txt'], ['id': 'bar', 'input': 'bar.txt'] ]`. + |* A csv file should have column names which correspond to the different arguments of this pipeline. Example: `--param_list data.csv` with columns `id,input`. + |* A json or a yaml file should be a list of maps, each of which has keys corresponding to the arguments of the pipeline. Example: `--param_list data.json` with contents `[ {'id': 'foo', 'input': 'foo.txt'}, {'id': 'bar', 'input': 'bar.txt'} ]`. + |* A yaml blob can also be passed directly as a string. Example: `--param_list "[ {'id': 'foo', 'input': 'foo.txt'}, {'id': 'bar', 'input': 'bar.txt'} ]"`. + | + |When passing a csv, json or yaml file, relative path names are relativized to the location of the parameter file. No relativation is performed when `param_list` is a list of maps (as-is) or a yaml blob.'''.stripMargin(), + 'example': 'my_params.yaml', + 'multiple': false, + 'hidden': true + ] + // TODO: allow multiple: true in param_list? + // TODO: allow to specify a --param_list_regex to filter the param_list? + // TODO: allow to specify a --param_list_from_state to remap entries in the param_list? + ] + ] + ] + ] + + return processConfig(_mergeMap(config, localConfig)) +} + +def _mergeMap(Map lhs, Map rhs) { + return rhs.inject(lhs.clone()) { map, entry -> + if (map[entry.key] instanceof Map && entry.value instanceof Map) { + map[entry.key] = _mergeMap(map[entry.key], entry.value) + } else if (map[entry.key] instanceof Collection && entry.value instanceof Collection) { + map[entry.key] += entry.value + } else { + map[entry.key] = entry.value + } + return map + } +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/config/generateHelp.nf' +def _generateArgumentHelp(param) { + // alternatives are not supported + // def names = param.alternatives ::: List(param.name) + + def unnamedProps = [ + ["required parameter", param.required], + ["multiple values allowed", param.multiple], + ["output", param.direction.toLowerCase() == "output"], + ["file must exist", param.type == "file" && param.must_exist] + ].findAll{it[1]}.collect{it[0]} + + def dflt = null + if (param.default != null) { + if (param.default instanceof List) { + dflt = param.default.join(param.multiple_sep != null ? param.multiple_sep : ", ") + } else { + dflt = param.default.toString() + } + } + def example = null + if (param.example != null) { + if (param.example instanceof List) { + example = param.example.join(param.multiple_sep != null ? param.multiple_sep : ", ") + } else { + example = param.example.toString() + } + } + def min = param.min?.toString() + def max = param.max?.toString() + + def escapeChoice = { choice -> + def s1 = choice.replaceAll("\\n", "\\\\n") + def s2 = s1.replaceAll("\"", """\\\"""") + s2.contains(",") || s2 != choice ? "\"" + s2 + "\"" : s2 + } + def choices = param.choices == null ? + null : + "[ " + param.choices.collect{escapeChoice(it.toString())}.join(", ") + " ]" + + def namedPropsStr = [ + ["type", ([param.type] + unnamedProps).join(", ")], + ["default", dflt], + ["example", example], + ["choices", choices], + ["min", min], + ["max", max] + ] + .findAll{it[1]} + .collect{"\n " + it[0] + ": " + it[1].replaceAll("\n", "\\n")} + .join("") + + def descStr = param.description == null ? + "" : + _paragraphWrap("\n" + param.description.trim(), 80 - 8).join("\n ") + + "\n --" + param.plainName + + namedPropsStr + + descStr +} + +// Based on Helper.generateHelp() in Helper.scala +def _generateHelp(config) { + def fun = config + + // PART 1: NAME AND VERSION + def nameStr = fun.name + + (fun.version == null ? "" : " " + fun.version) + + // PART 2: DESCRIPTION + def descrStr = fun.description == null ? + "" : + "\n\n" + _paragraphWrap(fun.description.trim(), 80).join("\n") + + // PART 3: Usage + def usageStr = fun.usage == null ? + "" : + "\n\nUsage:\n" + fun.usage.trim() + + // PART 4: Options + def argGroupStrs = fun.allArgumentGroups.collect{argGroup -> + def name = argGroup.name + def descriptionStr = argGroup.description == null ? + "" : + "\n " + _paragraphWrap(argGroup.description.trim(), 80-4).join("\n ") + "\n" + def arguments = argGroup.arguments.collect{arg -> + arg instanceof String ? fun.allArguments.find{it.plainName == arg} : arg + }.findAll{it != null} + def argumentStrs = arguments.collect{param -> _generateArgumentHelp(param)} + + "\n\n$name:" + + descriptionStr + + argumentStrs.join("\n") + } + + // FINAL: combine + def out = nameStr + + descrStr + + usageStr + + argGroupStrs.join("") + + return out +} + +// based on Format._paragraphWrap +def _paragraphWrap(str, maxLength) { + def outLines = [] + str.split("\n").each{par -> + def words = par.split("\\s").toList() + + def word = null + def line = words.pop() + while(!words.isEmpty()) { + word = words.pop() + if (line.length() + word.length() + 1 <= maxLength) { + line = line + " " + word + } else { + outLines.add(line) + line = word + } + } + if (words.isEmpty()) { + outLines.add(line) + } + } + return outLines +} + +def helpMessage(config) { + if (params.containsKey("help") && params.help) { + def mergedConfig = addGlobalArguments(config) + def helpStr = _generateHelp(mergedConfig) + println(helpStr) + exit 0 + } +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/config/processConfig.nf' +def processConfig(config) { + // set defaults for arguments + config.arguments = + (config.arguments ?: []).collect{_processArgument(it)} + + // set defaults for argument_group arguments + config.argument_groups = + (config.argument_groups ?: []).collect{grp -> + grp.arguments = (grp.arguments ?: []).collect{_processArgument(it)} + grp + } + + // create combined arguments list + config.allArguments = + config.arguments + + config.argument_groups.collectMany{it.arguments} + + // add missing argument groups (based on Functionality::allArgumentGroups()) + def argGroups = config.argument_groups + if (argGroups.any{it.name.toLowerCase() == "arguments"}) { + argGroups = argGroups.collect{ grp -> + if (grp.name.toLowerCase() == "arguments") { + grp = grp + [ + arguments: grp.arguments + config.arguments + ] + } + grp + } + } else { + argGroups = argGroups + [ + name: "Arguments", + arguments: config.arguments + ] + } + config.allArgumentGroups = argGroups + + config +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/config/readConfig.nf' + +def readConfig(file) { + def config = readYaml(file ?: moduleDir.resolve("config.vsh.yaml")) + processConfig(config) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/functions/_resolveSiblingIfNotAbsolute.nf' +/** + * Resolve a path relative to the current file. + * + * @param str The path to resolve, as a String. + * @param parentPath The path to resolve relative to, as a Path. + * + * @return The path that may have been resovled, as a Path. + */ +def _resolveSiblingIfNotAbsolute(str, parentPath) { + if (str !instanceof String) { + return str + } + if (!_stringIsAbsolutePath(str)) { + return parentPath.resolveSibling(str) + } else { + return file(str, hidden: true) + } +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/functions/_stringIsAbsolutePath.nf' +/** + * Check whether a path as a string is absolute. + * + * In the past, we tried using `file(., relative: true).isAbsolute()`, + * but the 'relative' option was added in 22.10.0. + * + * @param path The path to check, as a String. + * + * @return Whether the path is absolute, as a boolean. + */ +def _stringIsAbsolutePath(path) { + def _resolve_URL_PROTOCOL = ~/^([a-zA-Z][a-zA-Z0-9]*:)?\\/.+/ + + assert path instanceof String + return _resolve_URL_PROTOCOL.matcher(path).matches() +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/functions/collectTraces.nf' +class CustomTraceObserver implements nextflow.trace.TraceObserver { + List traces + + CustomTraceObserver(List traces) { + this.traces = traces + } + + @Override + void onProcessComplete(nextflow.processor.TaskHandler handler, nextflow.trace.TraceRecord trace) { + def trace2 = trace.store.clone() + trace2.script = null + traces.add(trace2) + } + + @Override + void onProcessCached(nextflow.processor.TaskHandler handler, nextflow.trace.TraceRecord trace) { + def trace2 = trace.store.clone() + trace2.script = null + traces.add(trace2) + } +} + +def collectTraces() { + def traces = Collections.synchronizedList([]) + + // add custom trace observer which stores traces in the traces object + session.observers.add(new CustomTraceObserver(traces)) + + traces +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/functions/deepClone.nf' +/** + * Performs a deep clone of the given object. + * @param x an object + */ +def deepClone(x) { + iterateMap(x, {it instanceof Cloneable ? it.clone() : it}) +} +// helper file: 'src/main/resources/io/viash/runners/nextflow/functions/getPublishDir.nf' +def getPublishDir() { + return params.containsKey("publish_dir") ? params.publish_dir : + params.containsKey("publishDir") ? params.publishDir : + null +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/functions/getRootDir.nf' + +// Recurse upwards until we find a '.build.yaml' file +def _findBuildYamlFile(pathPossiblySymlink) { + def path = pathPossiblySymlink.toRealPath() + def child = path.resolve(".build.yaml") + if (java.nio.file.Files.isDirectory(path) && java.nio.file.Files.exists(child)) { + return child + } else { + def parent = path.getParent() + if (parent == null) { + return null + } else { + return _findBuildYamlFile(parent) + } + } +} + +// get the root of the target folder +def getRootDir() { + def dir = _findBuildYamlFile(meta.resources_dir) + assert dir != null: "Could not find .build.yaml in the folder structure" + dir.getParent() +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/functions/iterateMap.nf' +/** + * Recursively apply a function over the leaves of an object. + * @param obj The object to iterate over. + * @param fun The function to apply to each value. + * @return The object with the function applied to each value. + */ +def iterateMap(obj, fun) { + if (obj instanceof List && obj !instanceof String) { + return obj.collect{item -> + iterateMap(item, fun) + } + } else if (obj instanceof Map) { + return obj.collectEntries{key, item -> + [key.toString(), iterateMap(item, fun)] + } + } else { + return fun(obj) + } +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/functions/niceView.nf' +/** + * A view for printing the event of each channel as a YAML blob. + * This is useful for debugging. + */ +def niceView() { + workflow niceViewWf { + take: input + main: + output = input + | view{toYamlBlob(it)} + emit: output + } + return niceViewWf +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/readCsv.nf' + +def readCsv(file_path) { + def output = [] + def inputFile = file_path !instanceof Path ? file(file_path, hidden: true) : file_path + + // todo: allow escaped quotes in string + // todo: allow single quotes? + def splitRegex = java.util.regex.Pattern.compile(''',(?=(?:[^"]*"[^"]*")*[^"]*$)''') + def removeQuote = java.util.regex.Pattern.compile('''"(.*)"''') + + def br = java.nio.file.Files.newBufferedReader(inputFile) + + def row = -1 + def header = null + while (br.ready() && header == null) { + def line = br.readLine() + row++ + if (!line.startsWith("#")) { + header = splitRegex.split(line, -1).collect{field -> + m = removeQuote.matcher(field) + m.find() ? m.replaceFirst('$1') : field + } + } + } + assert header != null: "CSV file should contain a header" + + while (br.ready()) { + def line = br.readLine() + row++ + if (line == null) { + br.close() + break + } + + if (!line.startsWith("#")) { + def predata = splitRegex.split(line, -1) + def data = predata.collect{field -> + if (field == "") { + return null + } + def m = removeQuote.matcher(field) + if (m.find()) { + return m.replaceFirst('$1') + } else { + return field + } + } + assert header.size() == data.size(): "Row $row should contain the same number as fields as the header" + + def dataMap = [header, data].transpose().collectEntries().findAll{it.value != null} + output.add(dataMap) + } + } + + output +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/readJson.nf' +def readJson(file_path) { + def inputFile = file_path !instanceof Path ? file(file_path, hidden: true) : file_path + def jsonSlurper = new groovy.json.JsonSlurper() + jsonSlurper.parse(inputFile) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/readJsonBlob.nf' +def readJsonBlob(str) { + def jsonSlurper = new groovy.json.JsonSlurper() + jsonSlurper.parseText(str) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/readTaggedYaml.nf' +// Custom constructor to modify how certain objects are parsed from YAML +class CustomConstructor extends org.yaml.snakeyaml.constructor.Constructor { + Path root + + class ConstructPath extends org.yaml.snakeyaml.constructor.AbstractConstruct { + public Object construct(org.yaml.snakeyaml.nodes.Node node) { + String filename = (String) constructScalar(node); + if (root != null) { + return root.resolve(filename); + } + return java.nio.file.Paths.get(filename); + } + } + + CustomConstructor(org.yaml.snakeyaml.LoaderOptions options, Path root) { + super(options) + this.root = root + // Handling !file tag and parse it back to a File type + this.yamlConstructors.put(new org.yaml.snakeyaml.nodes.Tag("!file"), new ConstructPath()) + } +} + +def readTaggedYaml(Path path) { + def options = new org.yaml.snakeyaml.LoaderOptions() + def constructor = new CustomConstructor(options, path.getParent()) + def yaml = new org.yaml.snakeyaml.Yaml(constructor) + return yaml.load(path.text) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/readYaml.nf' +def readYaml(file_path) { + def inputFile = file_path !instanceof Path ? file(file_path, hidden: true) : file_path + def yamlSlurper = new org.yaml.snakeyaml.Yaml() + yamlSlurper.load(inputFile) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/readYamlBlob.nf' +def readYamlBlob(str) { + def yamlSlurper = new org.yaml.snakeyaml.Yaml() + yamlSlurper.load(str) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/toJsonBlob.nf' +String toJsonBlob(data) { + return groovy.json.JsonOutput.toJson(data) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/toTaggedYamlBlob.nf' +// Custom representer to modify how certain objects are represented in YAML +class CustomRepresenter extends org.yaml.snakeyaml.representer.Representer { + Path relativizer + + class RepresentPath implements org.yaml.snakeyaml.representer.Represent { + public String getFileName(Object obj) { + if (obj instanceof File) { + obj = ((File) obj).toPath(); + } + if (obj !instanceof Path) { + throw new IllegalArgumentException("Object: " + obj + " is not a Path or File"); + } + def path = (Path) obj; + + if (relativizer != null) { + return relativizer.relativize(path).toString() + } else { + return path.toString() + } + } + + public org.yaml.snakeyaml.nodes.Node representData(Object data) { + String filename = getFileName(data); + def tag = new org.yaml.snakeyaml.nodes.Tag("!file"); + return representScalar(tag, filename); + } + } + CustomRepresenter(org.yaml.snakeyaml.DumperOptions options, Path relativizer) { + super(options) + this.relativizer = relativizer + this.representers.put(sun.nio.fs.UnixPath, new RepresentPath()) + this.representers.put(Path, new RepresentPath()) + this.representers.put(File, new RepresentPath()) + } +} + +String toTaggedYamlBlob(data) { + return toRelativeTaggedYamlBlob(data, null) +} +String toRelativeTaggedYamlBlob(data, Path relativizer) { + def options = new org.yaml.snakeyaml.DumperOptions() + options.setDefaultFlowStyle(org.yaml.snakeyaml.DumperOptions.FlowStyle.BLOCK) + def representer = new CustomRepresenter(options, relativizer) + def yaml = new org.yaml.snakeyaml.Yaml(representer, options) + return yaml.dump(data) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/toYamlBlob.nf' +String toYamlBlob(data) { + def options = new org.yaml.snakeyaml.DumperOptions() + options.setDefaultFlowStyle(org.yaml.snakeyaml.DumperOptions.FlowStyle.BLOCK) + options.setPrettyFlow(true) + def yaml = new org.yaml.snakeyaml.Yaml(options) + def cleanData = iterateMap(data, { it instanceof Path ? it.toString() : it }) + return yaml.dump(cleanData) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/writeJson.nf' +void writeJson(data, file) { + assert data: "writeJson: data should not be null" + assert file: "writeJson: file should not be null" + file.write(toJsonBlob(data)) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/readwrite/writeYaml.nf' +void writeYaml(data, file) { + assert data: "writeYaml: data should not be null" + assert file: "writeYaml: file should not be null" + file.write(toYamlBlob(data)) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/states/findStates.nf' +def findStates(Map params, Map config) { + def auto_config = deepClone(config) + def auto_params = deepClone(params) + + auto_config = auto_config.clone() + // override arguments + auto_config.argument_groups = [] + auto_config.arguments = [ + [ + type: "string", + name: "--id", + description: "A dummy identifier", + required: false + ], + [ + type: "file", + name: "--input_states", + example: "/path/to/input/directory/**/state.yaml", + description: "Path to input directory containing the datasets to be integrated.", + required: true, + multiple: true, + multiple_sep: ";" + ], + [ + type: "string", + name: "--filter", + example: "foo/.*/state.yaml", + description: "Regex to filter state files by path.", + required: false + ], + // to do: make this a yaml blob? + [ + type: "string", + name: "--rename_keys", + example: ["newKey1:oldKey1", "newKey2:oldKey2"], + description: "Rename keys in the detected input files. This is useful if the input files do not match the set of input arguments of the workflow.", + required: false, + multiple: true, + multiple_sep: ";" + ], + [ + type: "string", + name: "--settings", + example: '{"output_dataset": "dataset.h5ad", "k": 10}', + description: "Global arguments as a JSON glob to be passed to all components.", + required: false + ] + ] + if (!(auto_params.containsKey("id"))) { + auto_params["id"] = "auto" + } + + // run auto config through processConfig once more + auto_config = processConfig(auto_config) + + workflow findStatesWf { + helpMessage(auto_config) + + output_ch = + channelFromParams(auto_params, auto_config) + | flatMap { autoId, args -> + + def globalSettings = args.settings ? readYamlBlob(args.settings) : [:] + + // look for state files in input dir + def stateFiles = args.input_states + + // filter state files by regex + if (args.filter) { + stateFiles = stateFiles.findAll{ stateFile -> + def stateFileStr = stateFile.toString() + def matcher = stateFileStr =~ args.filter + matcher.matches()} + } + + // read in states + def states = stateFiles.collect { stateFile -> + def state_ = readTaggedYaml(stateFile) + [state_.id, state_] + } + + // construct renameMap + if (args.rename_keys) { + def renameMap = args.rename_keys.collectEntries{renameString -> + def split = renameString.split(":") + assert split.size() == 2: "Argument 'rename_keys' should be of the form 'newKey:oldKey', or 'newKey:oldKey;newKey:oldKey' in case of multiple values" + split + } + + // rename keys in state, only let states through which have all keys + // also add global settings + states = states.collectMany{id, state -> + def newState = [:] + + for (key in renameMap.keySet()) { + def origKey = renameMap[key] + if (!(state.containsKey(origKey))) { + return [] + } + newState[key] = state[origKey] + } + + [[id, globalSettings + newState]] + } + } + + states + } + emit: + output_ch + } + + return findStatesWf +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/states/joinStates.nf' +def joinStates(Closure apply_) { + workflow joinStatesWf { + take: input_ch + main: + output_ch = input_ch + | toSortedList + | filter{ it.size() > 0 } + | map{ tups -> + def ids = tups.collect{it[0]} + def states = tups.collect{it[1]} + apply_(ids, states) + } + + emit: output_ch + } + return joinStatesWf +} +// helper file: 'src/main/resources/io/viash/runners/nextflow/states/publishStates.nf' +def collectFiles(obj) { + if (obj instanceof java.io.File || obj instanceof Path) { + return [obj] + } else if (obj instanceof List && obj !instanceof String) { + return obj.collectMany{item -> + collectFiles(item) + } + } else if (obj instanceof Map) { + return obj.collectMany{key, item -> + collectFiles(item) + } + } else { + return [] + } +} + +/** + * Recurse through a state and collect all input files and their target output filenames. + * @param obj The state to recurse through. + * @param prefix The prefix to prepend to the output filenames. + */ +def collectInputOutputPaths(obj, prefix) { + if (obj instanceof File || obj instanceof Path) { + def path = obj instanceof Path ? obj : obj.toPath() + def ext = path.getFileName().toString().find("\\.[^\\.]+\$") ?: "" + def newFilename = prefix + ext + return [[obj, newFilename]] + } else if (obj instanceof List && obj !instanceof String) { + return obj.withIndex().collectMany{item, ix -> + collectInputOutputPaths(item, prefix + "_" + ix) + } + } else if (obj instanceof Map) { + return obj.collectMany{key, item -> + collectInputOutputPaths(item, prefix + "." + key) + } + } else { + return [] + } +} + +def publishStates(Map args) { + def key_ = args.get("key") + def yamlTemplate_ = args.get("output_state", args.get("outputState", '$id.$key.state.yaml')) + + assert key_ != null : "publishStates: key must be specified" + + workflow publishStatesWf { + take: input_ch + main: + input_ch + | map { tup -> + def id_ = tup[0] + def state_ = tup[1] + + // the input files and the target output filenames + def inputoutputFilenames_ = collectInputOutputPaths(state_, id_ + "." + key_).transpose() + def inputFiles_ = inputoutputFilenames_[0] + def outputFilenames_ = inputoutputFilenames_[1] + + def yamlFilename = yamlTemplate_ + .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) + .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) + + // TODO: do the pathnames in state_ match up with the outputFilenames_? + + // convert state to yaml blob + def yamlBlob_ = toRelativeTaggedYamlBlob([id: id_] + state_, java.nio.file.Paths.get(yamlFilename)) + + [id_, yamlBlob_, yamlFilename, inputFiles_, outputFilenames_] + } + | publishStatesProc + emit: input_ch + } + return publishStatesWf +} +process publishStatesProc { + // todo: check publishpath? + publishDir path: "${getPublishDir()}/", mode: "copy" + tag "$id" + input: + tuple val(id), val(yamlBlob), val(yamlFile), path(inputFiles, stageAs: "_inputfile?/*"), val(outputFiles) + output: + tuple val(id), path{[yamlFile] + outputFiles} + script: + def copyCommands = [ + inputFiles instanceof List ? inputFiles : [inputFiles], + outputFiles instanceof List ? outputFiles : [outputFiles] + ] + .transpose() + .collectMany{infile, outfile -> + if (infile.toString() != outfile.toString()) { + [ + "[ -d \"\$(dirname '${outfile.toString()}')\" ] || mkdir -p \"\$(dirname '${outfile.toString()}')\"", + "cp -r '${infile.toString()}' '${outfile.toString()}'" + ] + } else { + // no need to copy if infile is the same as outfile + [] + } + } + """ +mkdir -p "\$(dirname '${yamlFile}')" +echo "Storing state as yaml" +echo '${yamlBlob}' > '${yamlFile}' +echo "Copying output files to destination folder" +${copyCommands.join("\n ")} +""" +} + + +// this assumes that the state contains no other values other than those specified in the config +def publishStatesByConfig(Map args) { + def config = args.get("config") + assert config != null : "publishStatesByConfig: config must be specified" + + def key_ = args.get("key", config.name) + assert key_ != null : "publishStatesByConfig: key must be specified" + + workflow publishStatesSimpleWf { + take: input_ch + main: + input_ch + | map { tup -> + def id_ = tup[0] + def state_ = tup[1] // e.g. [output: new File("myoutput.h5ad"), k: 10] + def origState_ = tup[2] // e.g. [output: '$id.$key.foo.h5ad'] + + // TODO: allow overriding the state.yaml template + // TODO TODO: if auto.publish == "state", add output_state as an argument + def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' + def yamlFilename = yamlTemplate + .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) + .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) + def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() + + // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where + // - key is a String + // - value is any object that can be serialized to a Yaml (so a String/Integer/Long/Double/Boolean, a List, a Map, or a Path) + // - inputPath is a List[Path] + // - outputFilename is a List[String] + // - (key, value) are the tuples that will be saved to the state.yaml file + // - (inputPath, outputFilename) are the files that will be copied from src to dest (relative to the state.yaml) + def processedState = + config.allArguments + .findAll { it.direction == "output" } + .collectMany { par -> + def plainName_ = par.plainName + // if the state does not contain the key, it's an + // optional argument for which the component did + // not generate any output + if (!state_.containsKey(plainName_)) { + return [] + } + def value = state_[plainName_] + // if the parameter is not a file, it should be stored + // in the state as-is, but is not something that needs + // to be copied from the source path to the dest path + if (par.type != "file") { + return [[key: plainName_, value: value, inputPath: [], outputFilename: []]] + } + // if the orig state does not contain this filename, + // it's an optional argument for which the user specified + // that it should not be returned as a state + if (!origState_.containsKey(plainName_)) { + return [] + } + def filenameTemplate = origState_[plainName_] + // if the pararameter is multiple: true, fetch the template + if (par.multiple && filenameTemplate instanceof List) { + filenameTemplate = filenameTemplate[0] + } + // instantiate the template + def filename = filenameTemplate + .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) + .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) + if (par.multiple) { + // if the parameter is multiple: true, the filename + // should contain a wildcard '*' that is replaced with + // the index of the file + assert filename.contains("*") : "Module '${key_}' id '${id_}': Multiple output files specified, but no wildcard '*' in the filename: ${filename}" + def outputPerFile = value.withIndex().collect{ val, ix -> + def filename_ix = filename.replace("*", ix.toString()) + def value_ = java.nio.file.Paths.get(filename_ix) + // if id contains a slash + if (yamlDir != null) { + value_ = yamlDir.relativize(value_) + } + def inputPath = val instanceof File ? val.toPath() : val + [value: value_, inputPath: inputPath, outputFilename: filename_ix] + } + def transposedOutputs = ["value", "inputPath", "outputFilename"].collectEntries{ key -> + [key, outputPerFile.collect{dic -> dic[key]}] + } + return [[key: plainName_] + transposedOutputs] + } else { + def value_ = java.nio.file.Paths.get(filename) + // if id contains a slash + if (yamlDir != null) { + value_ = yamlDir.relativize(value_) + } + def inputPath = value instanceof File ? value.toPath() : value + return [[key: plainName_, value: value_, inputPath: [inputPath], outputFilename: [filename]]] + } + } + + def updatedState_ = processedState.collectEntries{[it.key, it.value]} + def inputPaths = processedState.collectMany{it.inputPath} + def outputFilenames = processedState.collectMany{it.outputFilename} + + // convert state to yaml blob + def yamlBlob_ = toTaggedYamlBlob([id: id_] + updatedState_) + + [id_, yamlBlob_, yamlFilename, inputPaths, outputFilenames] + } + | publishStatesProc + emit: input_ch + } + return publishStatesSimpleWf +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/states/setState.nf' +def setState(fun) { + assert fun instanceof Closure || fun instanceof Map || fun instanceof List : + "Error in setState: Expected process argument to be a Closure, a Map, or a List. Found: class ${fun.getClass()}" + + // if fun is a List, convert to map + if (fun instanceof List) { + // check whether fun is a list[string] + assert fun.every{it instanceof CharSequence} : "Error in setState: argument is a List, but not all elements are Strings" + fun = fun.collectEntries{[it, it]} + } + + // if fun is a map, convert to closure + if (fun instanceof Map) { + // check whether fun is a map[string, string] + assert fun.values().every{it instanceof CharSequence} : "Error in setState: argument is a Map, but not all values are Strings" + assert fun.keySet().every{it instanceof CharSequence} : "Error in setState: argument is a Map, but not all keys are Strings" + def funMap = fun.clone() + // turn the map into a closure to be used later on + fun = { id_, state_ -> + assert state_ instanceof Map : "Error in setState: the state is not a Map" + funMap.collectMany{newkey, origkey -> + if (state_.containsKey(origkey)) { + [[newkey, state_[origkey]]] + } else { + [] + } + }.collectEntries() + } + } + + map { tup -> + def id = tup[0] + def state = tup[1] + def unfilteredState = fun(id, state) + def newState = unfilteredState.findAll{key, val -> val != null} + [id, newState] + tup.drop(2) + } +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/workflowFactory/processAuto.nf' +// TODO: unit test processAuto +def processAuto(Map auto) { + // remove null values + auto = auto.findAll{k, v -> v != null} + + // check for unexpected keys + def expectedKeys = ["simplifyInput", "simplifyOutput", "transcript", "publish"] + def unexpectedKeys = auto.keySet() - expectedKeys + assert unexpectedKeys.isEmpty(), "unexpected keys in auto: '${unexpectedKeys.join("', '")}'" + + // check auto.simplifyInput + assert auto.simplifyInput instanceof Boolean, "auto.simplifyInput must be a boolean" + + // check auto.simplifyOutput + assert auto.simplifyOutput instanceof Boolean, "auto.simplifyOutput must be a boolean" + + // check auto.transcript + assert auto.transcript instanceof Boolean, "auto.transcript must be a boolean" + + // check auto.publish + assert auto.publish instanceof Boolean || auto.publish == "state", "auto.publish must be a boolean or 'state'" + + return auto.subMap(expectedKeys) +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/workflowFactory/processDirectives.nf' +def assertMapKeys(map, expectedKeys, requiredKeys, mapName) { + assert map instanceof Map : "Expected argument '$mapName' to be a Map. Found: class ${map.getClass()}" + map.forEach { key, val -> + assert key in expectedKeys : "Unexpected key '$key' in ${mapName ? mapName + " " : ""}map" + } + requiredKeys.forEach { requiredKey -> + assert map.containsKey(requiredKey) : "Missing required key '$key' in ${mapName ? mapName + " " : ""}map" + } +} + +// TODO: unit test processDirectives +def processDirectives(Map drctv) { + // remove null values + drctv = drctv.findAll{k, v -> v != null} + + // check for unexpected keys + def expectedKeys = [ + "accelerator", "afterScript", "beforeScript", "cache", "conda", "container", "containerOptions", "cpus", "disk", "echo", "errorStrategy", "executor", "machineType", "maxErrors", "maxForks", "maxRetries", "memory", "module", "penv", "pod", "publishDir", "queue", "label", "scratch", "storeDir", "stageInMode", "stageOutMode", "tag", "time" + ] + def unexpectedKeys = drctv.keySet() - expectedKeys + assert unexpectedKeys.isEmpty() : "Unexpected keys in process directive: '${unexpectedKeys.join("', '")}'" + + /* DIRECTIVE accelerator + accepted examples: + - [ limit: 4, type: "nvidia-tesla-k80" ] + */ + if (drctv.containsKey("accelerator")) { + assertMapKeys(drctv["accelerator"], ["type", "limit", "request", "runtime"], [], "accelerator") + } + + /* DIRECTIVE afterScript + accepted examples: + - "source /cluster/bin/cleanup" + */ + if (drctv.containsKey("afterScript")) { + assert drctv["afterScript"] instanceof CharSequence + } + + /* DIRECTIVE beforeScript + accepted examples: + - "source /cluster/bin/setup" + */ + if (drctv.containsKey("beforeScript")) { + assert drctv["beforeScript"] instanceof CharSequence + } + + /* DIRECTIVE cache + accepted examples: + - true + - false + - "deep" + - "lenient" + */ + if (drctv.containsKey("cache")) { + assert drctv["cache"] instanceof CharSequence || drctv["cache"] instanceof Boolean + if (drctv["cache"] instanceof CharSequence) { + assert drctv["cache"] in ["deep", "lenient"] : "Unexpected value for cache" + } + } + + /* DIRECTIVE conda + accepted examples: + - "bwa=0.7.15" + - "bwa=0.7.15 fastqc=0.11.5" + - ["bwa=0.7.15", "fastqc=0.11.5"] + */ + if (drctv.containsKey("conda")) { + if (drctv["conda"] instanceof List) { + drctv["conda"] = drctv["conda"].join(" ") + } + assert drctv["conda"] instanceof CharSequence + } + + /* DIRECTIVE container + accepted examples: + - "foo/bar:tag" + - [ registry: "reg", image: "im", tag: "ta" ] + is transformed to "reg/im:ta" + - [ image: "im" ] + is transformed to "im:latest" + */ + if (drctv.containsKey("container")) { + assert drctv["container"] instanceof Map || drctv["container"] instanceof CharSequence + if (drctv["container"] instanceof Map) { + def m = drctv["container"] + assertMapKeys(m, [ "registry", "image", "tag" ], ["image"], "container") + def part1 = + System.getenv('OVERRIDE_CONTAINER_REGISTRY') ? System.getenv('OVERRIDE_CONTAINER_REGISTRY') + "/" : + params.containsKey("override_container_registry") ? params["override_container_registry"] + "/" : // todo: remove? + m.registry ? m.registry + "/" : + "" + def part2 = m.image + def part3 = m.tag ? ":" + m.tag : ":latest" + drctv["container"] = part1 + part2 + part3 + } + } + + /* DIRECTIVE containerOptions + accepted examples: + - "--foo bar" + - ["--foo bar", "-f b"] + */ + if (drctv.containsKey("containerOptions")) { + if (drctv["containerOptions"] instanceof List) { + drctv["containerOptions"] = drctv["containerOptions"].join(" ") + } + assert drctv["containerOptions"] instanceof CharSequence + } + + /* DIRECTIVE cpus + accepted examples: + - 1 + - 10 + */ + if (drctv.containsKey("cpus")) { + assert drctv["cpus"] instanceof Integer + } + + /* DIRECTIVE disk + accepted examples: + - "1 GB" + - "2TB" + - "3.2KB" + - "10.B" + */ + if (drctv.containsKey("disk")) { + assert drctv["disk"] instanceof CharSequence + // assert drctv["disk"].matches("[0-9]+(\\.[0-9]*)? *[KMGTPEZY]?B") + // ^ does not allow closures + } + + /* DIRECTIVE echo + accepted examples: + - true + - false + */ + if (drctv.containsKey("echo")) { + assert drctv["echo"] instanceof Boolean + } + + /* DIRECTIVE errorStrategy + accepted examples: + - "terminate" + - "finish" + */ + if (drctv.containsKey("errorStrategy")) { + assert drctv["errorStrategy"] instanceof CharSequence + assert drctv["errorStrategy"] in ["terminate", "finish", "ignore", "retry"] : "Unexpected value for errorStrategy" + } + + /* DIRECTIVE executor + accepted examples: + - "local" + - "sge" + */ + if (drctv.containsKey("executor")) { + assert drctv["executor"] instanceof CharSequence + assert drctv["executor"] in ["local", "sge", "uge", "lsf", "slurm", "pbs", "pbspro", "moab", "condor", "nqsii", "ignite", "k8s", "awsbatch", "google-pipelines"] : "Unexpected value for executor" + } + + /* DIRECTIVE machineType + accepted examples: + - "n1-highmem-8" + */ + if (drctv.containsKey("machineType")) { + assert drctv["machineType"] instanceof CharSequence + } + + /* DIRECTIVE maxErrors + accepted examples: + - 1 + - 3 + */ + if (drctv.containsKey("maxErrors")) { + assert drctv["maxErrors"] instanceof Integer + } + + /* DIRECTIVE maxForks + accepted examples: + - 1 + - 3 + */ + if (drctv.containsKey("maxForks")) { + assert drctv["maxForks"] instanceof Integer + } + + /* DIRECTIVE maxRetries + accepted examples: + - 1 + - 3 + */ + if (drctv.containsKey("maxRetries")) { + assert drctv["maxRetries"] instanceof Integer + } + + /* DIRECTIVE memory + accepted examples: + - "1 GB" + - "2TB" + - "3.2KB" + - "10.B" + */ + if (drctv.containsKey("memory")) { + assert drctv["memory"] instanceof CharSequence + // assert drctv["memory"].matches("[0-9]+(\\.[0-9]*)? *[KMGTPEZY]?B") + // ^ does not allow closures + } + + /* DIRECTIVE module + accepted examples: + - "ncbi-blast/2.2.27" + - "ncbi-blast/2.2.27:t_coffee/10.0" + - ["ncbi-blast/2.2.27", "t_coffee/10.0"] + */ + if (drctv.containsKey("module")) { + if (drctv["module"] instanceof List) { + drctv["module"] = drctv["module"].join(":") + } + assert drctv["module"] instanceof CharSequence + } + + /* DIRECTIVE penv + accepted examples: + - "smp" + */ + if (drctv.containsKey("penv")) { + assert drctv["penv"] instanceof CharSequence + } + + /* DIRECTIVE pod + accepted examples: + - [ label: "key", value: "val" ] + - [ annotation: "key", value: "val" ] + - [ env: "key", value: "val" ] + - [ [label: "l", value: "v"], [env: "e", value: "v"]] + */ + if (drctv.containsKey("pod")) { + if (drctv["pod"] instanceof Map) { + drctv["pod"] = [ drctv["pod"] ] + } + assert drctv["pod"] instanceof List + drctv["pod"].forEach { pod -> + assert pod instanceof Map + // TODO: should more checks be added? + // See https://www.nextflow.io/docs/latest/process.html?highlight=directives#pod + // e.g. does it contain 'label' and 'value', or 'annotation' and 'value', or ...? + } + } + + /* DIRECTIVE publishDir + accepted examples: + - [] + - [ [ path: "foo", enabled: true ], [ path: "bar", enabled: false ] ] + - "/path/to/dir" + is transformed to [[ path: "/path/to/dir" ]] + - [ path: "/path/to/dir", mode: "cache" ] + is transformed to [[ path: "/path/to/dir", mode: "cache" ]] + */ + // TODO: should we also look at params["publishDir"]? + if (drctv.containsKey("publishDir")) { + def pblsh = drctv["publishDir"] + + // check different options + assert pblsh instanceof List || pblsh instanceof Map || pblsh instanceof CharSequence + + // turn into list if not already so + // for some reason, 'if (!pblsh instanceof List) pblsh = [ pblsh ]' doesn't work. + pblsh = pblsh instanceof List ? pblsh : [ pblsh ] + + // check elements of publishDir + pblsh = pblsh.collect{ elem -> + // turn into map if not already so + elem = elem instanceof CharSequence ? [ path: elem ] : elem + + // check types and keys + assert elem instanceof Map : "Expected publish argument '$elem' to be a String or a Map. Found: class ${elem.getClass()}" + assertMapKeys(elem, [ "path", "mode", "overwrite", "pattern", "saveAs", "enabled" ], ["path"], "publishDir") + + // check elements in map + assert elem.containsKey("path") + assert elem["path"] instanceof CharSequence + if (elem.containsKey("mode")) { + assert elem["mode"] instanceof CharSequence + assert elem["mode"] in [ "symlink", "rellink", "link", "copy", "copyNoFollow", "move" ] + } + if (elem.containsKey("overwrite")) { + assert elem["overwrite"] instanceof Boolean + } + if (elem.containsKey("pattern")) { + assert elem["pattern"] instanceof CharSequence + } + if (elem.containsKey("saveAs")) { + assert elem["saveAs"] instanceof CharSequence //: "saveAs as a Closure is currently not supported. Surround your closure with single quotes to get the desired effect. Example: '\{ foo \}'" + } + if (elem.containsKey("enabled")) { + assert elem["enabled"] instanceof Boolean + } + + // return final result + elem + } + // store final directive + drctv["publishDir"] = pblsh + } + + /* DIRECTIVE queue + accepted examples: + - "long" + - "short,long" + - ["short", "long"] + */ + if (drctv.containsKey("queue")) { + if (drctv["queue"] instanceof List) { + drctv["queue"] = drctv["queue"].join(",") + } + assert drctv["queue"] instanceof CharSequence + } + + /* DIRECTIVE label + accepted examples: + - "big_mem" + - "big_cpu" + - ["big_mem", "big_cpu"] + */ + if (drctv.containsKey("label")) { + if (drctv["label"] instanceof CharSequence) { + drctv["label"] = [ drctv["label"] ] + } + assert drctv["label"] instanceof List + drctv["label"].forEach { label -> + assert label instanceof CharSequence + // assert label.matches("[a-zA-Z0-9]([a-zA-Z0-9_]*[a-zA-Z0-9])?") + // ^ does not allow closures + } + } + + /* DIRECTIVE scratch + accepted examples: + - true + - "/path/to/scratch" + - '$MY_PATH_TO_SCRATCH' + - "ram-disk" + */ + if (drctv.containsKey("scratch")) { + assert drctv["scratch"] == true || drctv["scratch"] instanceof CharSequence + } + + /* DIRECTIVE storeDir + accepted examples: + - "/path/to/storeDir" + */ + if (drctv.containsKey("storeDir")) { + assert drctv["storeDir"] instanceof CharSequence + } + + /* DIRECTIVE stageInMode + accepted examples: + - "copy" + - "link" + */ + if (drctv.containsKey("stageInMode")) { + assert drctv["stageInMode"] instanceof CharSequence + assert drctv["stageInMode"] in ["copy", "link", "symlink", "rellink"] + } + + /* DIRECTIVE stageOutMode + accepted examples: + - "copy" + - "link" + */ + if (drctv.containsKey("stageOutMode")) { + assert drctv["stageOutMode"] instanceof CharSequence + assert drctv["stageOutMode"] in ["copy", "move", "rsync"] + } + + /* DIRECTIVE tag + accepted examples: + - "foo" + - '$id' + */ + if (drctv.containsKey("tag")) { + assert drctv["tag"] instanceof CharSequence + } + + /* DIRECTIVE time + accepted examples: + - "1h" + - "2days" + - "1day 6hours 3minutes 30seconds" + */ + if (drctv.containsKey("time")) { + assert drctv["time"] instanceof CharSequence + // todo: validation regex? + } + + return drctv +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/workflowFactory/processWorkflowArgs.nf' +def processWorkflowArgs(Map args, Map defaultWfArgs, Map meta) { + // override defaults with args + def workflowArgs = defaultWfArgs + args + + // check whether 'key' exists + assert workflowArgs.containsKey("key") : "Error in module '${meta.config.name}': key is a required argument" + + // if 'key' is a closure, apply it to the original key + if (workflowArgs["key"] instanceof Closure) { + workflowArgs["key"] = workflowArgs["key"](meta.config.name) + } + def key = workflowArgs["key"] + assert key instanceof CharSequence : "Expected process argument 'key' to be a String. Found: class ${key.getClass()}" + assert key ==~ /^[a-zA-Z_]\w*$/ : "Error in module '$key': Expected process argument 'key' to consist of only letters, digits or underscores. Found: ${key}" + + // check for any unexpected keys + def expectedKeys = ["key", "directives", "auto", "map", "mapId", "mapData", "mapPassthrough", "filter", "runIf", "fromState", "toState", "args", "renameKeys", "debug"] + def unexpectedKeys = workflowArgs.keySet() - expectedKeys + assert unexpectedKeys.isEmpty() : "Error in module '$key': unexpected arguments to the '.run()' function: '${unexpectedKeys.join("', '")}'" + + // check whether directives exists and apply defaults + assert workflowArgs.containsKey("directives") : "Error in module '$key': directives is a required argument" + assert workflowArgs["directives"] instanceof Map : "Error in module '$key': Expected process argument 'directives' to be a Map. Found: class ${workflowArgs['directives'].getClass()}" + workflowArgs["directives"] = processDirectives(defaultWfArgs.directives + workflowArgs["directives"]) + + // check whether directives exists and apply defaults + assert workflowArgs.containsKey("auto") : "Error in module '$key': auto is a required argument" + assert workflowArgs["auto"] instanceof Map : "Error in module '$key': Expected process argument 'auto' to be a Map. Found: class ${workflowArgs['auto'].getClass()}" + workflowArgs["auto"] = processAuto(defaultWfArgs.auto + workflowArgs["auto"]) + + // auto define publish, if so desired + if (workflowArgs.auto.publish == true && (workflowArgs.directives.publishDir != null ? workflowArgs.directives.publishDir : [:]).isEmpty()) { + // can't assert at this level thanks to the no_publish profile + // assert params.containsKey("publishDir") || params.containsKey("publish_dir") : + // "Error in module '${workflowArgs['key']}': if auto.publish is true, params.publish_dir needs to be defined.\n" + + // " Example: params.publish_dir = \"./output/\"" + def publishDir = getPublishDir() + + if (publishDir != null) { + workflowArgs.directives.publishDir = [[ + path: publishDir, + saveAs: "{ it.startsWith('.') ? null : it }", // don't publish hidden files, by default + mode: "copy" + ]] + } + } + + // auto define transcript, if so desired + if (workflowArgs.auto.transcript == true) { + // can't assert at this level thanks to the no_publish profile + // assert params.containsKey("transcriptsDir") || params.containsKey("transcripts_dir") || params.containsKey("publishDir") || params.containsKey("publish_dir") : + // "Error in module '${workflowArgs['key']}': if auto.transcript is true, either params.transcripts_dir or params.publish_dir needs to be defined.\n" + + // " Example: params.transcripts_dir = \"./transcripts/\"" + def transcriptsDir = + params.containsKey("transcripts_dir") ? params.transcripts_dir : + params.containsKey("transcriptsDir") ? params.transcriptsDir : + params.containsKey("publish_dir") ? params.publish_dir + "/_transcripts" : + params.containsKey("publishDir") ? params.publishDir + "/_transcripts" : + null + if (transcriptsDir != null) { + def timestamp = nextflow.Nextflow.getSession().getWorkflowMetadata().start.format('yyyy-MM-dd_HH-mm-ss') + def transcriptsPublishDir = [ + path: "$transcriptsDir/$timestamp/\${task.process.replaceAll(':', '-')}/\${id}/", + saveAs: "{ it.startsWith('.') ? it.replaceAll('^.', '') : null }", + mode: "copy" + ] + def publishDirs = workflowArgs.directives.publishDir != null ? workflowArgs.directives.publishDir : null ? workflowArgs.directives.publishDir : [] + workflowArgs.directives.publishDir = publishDirs + transcriptsPublishDir + } + } + + // if this is a stubrun, remove certain directives? + if (workflow.stubRun) { + workflowArgs.directives.keySet().removeAll(["publishDir", "cpus", "memory", "label"]) + } + + for (nam in ["map", "mapId", "mapData", "mapPassthrough", "filter", "runIf"]) { + if (workflowArgs.containsKey(nam) && workflowArgs[nam]) { + assert workflowArgs[nam] instanceof Closure : "Error in module '$key': Expected process argument '$nam' to be null or a Closure. Found: class ${workflowArgs[nam].getClass()}" + } + } + + // TODO: should functions like 'map', 'mapId', 'mapData', 'mapPassthrough' be deprecated as well? + for (nam in ["map", "mapData", "mapPassthrough", "renameKeys"]) { + if (workflowArgs.containsKey(nam) && workflowArgs[nam] != null) { + log.warn "module '$key': workflow argument '$nam' is deprecated and will be removed in Viash 0.9.0. Please use 'fromState' and 'toState' instead." + } + } + + // check fromState + workflowArgs["fromState"] = _processFromState(workflowArgs.get("fromState"), key, meta.config) + + // check toState + workflowArgs["toState"] = _processToState(workflowArgs.get("toState"), key, meta.config) + + // return output + return workflowArgs +} + +def _processFromState(fromState, key_, config_) { + assert fromState == null || fromState instanceof Closure || fromState instanceof Map || fromState instanceof List : + "Error in module '$key_': Expected process argument 'fromState' to be null, a Closure, a Map, or a List. Found: class ${fromState.getClass()}" + if (fromState == null) { + return null + } + + // if fromState is a List, convert to map + if (fromState instanceof List) { + // check whether fromstate is a list[string] + assert fromState.every{it instanceof CharSequence} : "Error in module '$key_': fromState is a List, but not all elements are Strings" + fromState = fromState.collectEntries{[it, it]} + } + + // if fromState is a map, convert to closure + if (fromState instanceof Map) { + // check whether fromstate is a map[string, string] + assert fromState.values().every{it instanceof CharSequence} : "Error in module '$key_': fromState is a Map, but not all values are Strings" + assert fromState.keySet().every{it instanceof CharSequence} : "Error in module '$key_': fromState is a Map, but not all keys are Strings" + def fromStateMap = fromState.clone() + def requiredInputNames = meta.config.allArguments.findAll{it.required && it.direction == "Input"}.collect{it.plainName} + // turn the map into a closure to be used later on + fromState = { it -> + def state = it[1] + assert state instanceof Map : "Error in module '$key_': the state is not a Map" + def data = fromStateMap.collectMany{newkey, origkey -> + // check whether newkey corresponds to a required argument + if (state.containsKey(origkey)) { + [[newkey, state[origkey]]] + } else if (!requiredInputNames.contains(origkey)) { + [] + } else { + throw new Exception("Error in module '$key_': fromState key '$origkey' not found in current state") + } + }.collectEntries() + data + } + } + + return fromState +} + +def _processToState(toState, key_, config_) { + if (toState == null) { + toState = { tup -> tup[1] } + } + + // toState should be a closure, map[string, string], or list[string] + assert toState instanceof Closure || toState instanceof Map || toState instanceof List : + "Error in module '$key_': Expected process argument 'toState' to be a Closure, a Map, or a List. Found: class ${toState.getClass()}" + + // if toState is a List, convert to map + if (toState instanceof List) { + // check whether toState is a list[string] + assert toState.every{it instanceof CharSequence} : "Error in module '$key_': toState is a List, but not all elements are Strings" + toState = toState.collectEntries{[it, it]} + } + + // if toState is a map, convert to closure + if (toState instanceof Map) { + // check whether toState is a map[string, string] + assert toState.values().every{it instanceof CharSequence} : "Error in module '$key_': toState is a Map, but not all values are Strings" + assert toState.keySet().every{it instanceof CharSequence} : "Error in module '$key_': toState is a Map, but not all keys are Strings" + def toStateMap = toState.clone() + def requiredOutputNames = config_.allArguments.findAll{it.required && it.direction == "Output"}.collect{it.plainName} + // turn the map into a closure to be used later on + toState = { it -> + def output = it[1] + def state = it[2] + assert output instanceof Map : "Error in module '$key_': the output is not a Map" + assert state instanceof Map : "Error in module '$key_': the state is not a Map" + def extraEntries = toStateMap.collectMany{newkey, origkey -> + // check whether newkey corresponds to a required argument + if (output.containsKey(origkey)) { + [[newkey, output[origkey]]] + } else if (!requiredOutputNames.contains(origkey)) { + [] + } else { + throw new Exception("Error in module '$key_': toState key '$origkey' not found in current output") + } + }.collectEntries() + state + extraEntries + } + } + + return toState +} + +// helper file: 'src/main/resources/io/viash/runners/nextflow/workflowFactory/workflowFactory.nf' +def _debug(workflowArgs, debugKey) { + if (workflowArgs.debug) { + view { "process '${workflowArgs.key}' $debugKey tuple: $it" } + } else { + map { it } + } +} + +// depends on: innerWorkflowFactory +def workflowFactory(Map args, Map defaultWfArgs, Map meta) { + def workflowArgs = processWorkflowArgs(args, defaultWfArgs, meta) + def key_ = workflowArgs["key"] + + workflow workflowInstance { + take: input_ + + main: + def chModified = input_ + | checkUniqueIds([:]) + | _debug(workflowArgs, "input") + | map { tuple -> + tuple = deepClone(tuple) + + if (workflowArgs.map) { + tuple = workflowArgs.map(tuple) + } + if (workflowArgs.mapId) { + tuple[0] = workflowArgs.mapId(tuple[0]) + } + if (workflowArgs.mapData) { + tuple[1] = workflowArgs.mapData(tuple[1]) + } + if (workflowArgs.mapPassthrough) { + tuple = tuple.take(2) + workflowArgs.mapPassthrough(tuple.drop(2)) + } + + // check tuple + assert tuple instanceof List : + "Error in module '${key_}': element in channel should be a tuple [id, data, ...otherargs...]\n" + + " Example: [\"id\", [input: file('foo.txt'), arg: 10]].\n" + + " Expected class: List. Found: tuple.getClass() is ${tuple.getClass()}" + assert tuple.size() >= 2 : + "Error in module '${key_}': expected length of tuple in input channel to be two or greater.\n" + + " Example: [\"id\", [input: file('foo.txt'), arg: 10]].\n" + + " Found: tuple.size() == ${tuple.size()}" + + // check id field + if (tuple[0] instanceof GString) { + tuple[0] = tuple[0].toString() + } + assert tuple[0] instanceof CharSequence : + "Error in module '${key_}': first element of tuple in channel should be a String\n" + + " Example: [\"id\", [input: file('foo.txt'), arg: 10]].\n" + + " Found: ${tuple[0]}" + + // match file to input file + if (workflowArgs.auto.simplifyInput && (tuple[1] instanceof Path || tuple[1] instanceof List)) { + def inputFiles = meta.config.allArguments + .findAll { it.type == "file" && it.direction == "input" } + + assert inputFiles.size() == 1 : + "Error in module '${key_}' id '${tuple[0]}'.\n" + + " Anonymous file inputs are only allowed when the process has exactly one file input.\n" + + " Expected: inputFiles.size() == 1. Found: inputFiles.size() is ${inputFiles.size()}" + + tuple[1] = [[ inputFiles[0].plainName, tuple[1] ]].collectEntries() + } + + // check data field + assert tuple[1] instanceof Map : + "Error in module '${key_}' id '${tuple[0]}': second element of tuple in channel should be a Map\n" + + " Example: [\"id\", [input: file('foo.txt'), arg: 10]].\n" + + " Expected class: Map. Found: tuple[1].getClass() is ${tuple[1].getClass()}" + + // rename keys of data field in tuple + if (workflowArgs.renameKeys) { + assert workflowArgs.renameKeys instanceof Map : + "Error renaming data keys in module '${key_}' id '${tuple[0]}'.\n" + + " Example: renameKeys: ['new_key': 'old_key'].\n" + + " Expected class: Map. Found: renameKeys.getClass() is ${workflowArgs.renameKeys.getClass()}" + assert tuple[1] instanceof Map : + "Error renaming data keys in module '${key_}' id '${tuple[0]}'.\n" + + " Expected class: Map. Found: tuple[1].getClass() is ${tuple[1].getClass()}" + + // TODO: allow renameKeys to be a function? + workflowArgs.renameKeys.each { newKey, oldKey -> + assert newKey instanceof CharSequence : + "Error renaming data keys in module '${key_}' id '${tuple[0]}'.\n" + + " Example: renameKeys: ['new_key': 'old_key'].\n" + + " Expected class of newKey: String. Found: newKey.getClass() is ${newKey.getClass()}" + assert oldKey instanceof CharSequence : + "Error renaming data keys in module '${key_}' id '${tuple[0]}'.\n" + + " Example: renameKeys: ['new_key': 'old_key'].\n" + + " Expected class of oldKey: String. Found: oldKey.getClass() is ${oldKey.getClass()}" + assert tuple[1].containsKey(oldKey) : + "Error renaming data keys in module '${key}' id '${tuple[0]}'.\n" + + " Key '$oldKey' is missing in the data map. tuple[1].keySet() is '${tuple[1].keySet()}'" + tuple[1].put(newKey, tuple[1][oldKey]) + } + tuple[1].keySet().removeAll(workflowArgs.renameKeys.collect{ newKey, oldKey -> oldKey }) + } + tuple + } + + + def chRun = null + def chPassthrough = null + if (workflowArgs.runIf) { + def runIfBranch = chModified.branch{ tup -> + run: workflowArgs.runIf(tup[0], tup[1]) + passthrough: true + } + chRun = runIfBranch.run + chPassthrough = runIfBranch.passthrough + } else { + chRun = chModified + chPassthrough = Channel.empty() + } + + def chRunFiltered = workflowArgs.filter ? + chRun | filter{workflowArgs.filter(it)} : + chRun + + def chArgs = workflowArgs.fromState ? + chRunFiltered | map{ + def new_data = workflowArgs.fromState(it.take(2)) + [it[0], new_data] + } : + chRunFiltered | map {tup -> tup.take(2)} + + // fill in defaults + def chArgsWithDefaults = chArgs + | map { tuple -> + def id_ = tuple[0] + def data_ = tuple[1] + + // TODO: could move fromState to here + + // fetch default params from functionality + def defaultArgs = meta.config.allArguments + .findAll { it.containsKey("default") } + .collectEntries { [ it.plainName, it.default ] } + + // fetch overrides in params + def paramArgs = meta.config.allArguments + .findAll { par -> + def argKey = key_ + "__" + par.plainName + params.containsKey(argKey) + } + .collectEntries { [ it.plainName, params[key_ + "__" + it.plainName] ] } + + // fetch overrides in data + def dataArgs = meta.config.allArguments + .findAll { data_.containsKey(it.plainName) } + .collectEntries { [ it.plainName, data_[it.plainName] ] } + + // combine params + def combinedArgs = defaultArgs + paramArgs + workflowArgs.args + dataArgs + + // remove arguments with explicit null values + combinedArgs + .removeAll{_, val -> val == null || val == "viash_no_value" || val == "force_null"} + + combinedArgs = _processInputValues(combinedArgs, meta.config, id_, key_) + + [id_, combinedArgs] + tuple.drop(2) + } + + // TODO: move some of the _meta.join_id wrangling to the safeJoin() function. + def chInitialOutput = chArgsWithDefaults + | _debug(workflowArgs, "processed") + // run workflow + | innerWorkflowFactory(workflowArgs) + // check output tuple + | map { id_, output_ -> + + // see if output map contains metadata + def meta_ = + output_ instanceof Map && output_.containsKey("_meta") ? + output_["_meta"] : + [:] + def join_id = meta_.join_id ?: id_ + + // remove metadata + output_ = output_.findAll{k, v -> k != "_meta"} + + // check value types + output_ = _processOutputValues(output_, meta.config, id_, key_) + + // simplify output if need be + if (workflowArgs.auto.simplifyOutput && output_.size() == 1) { + output_ = output_.values()[0] + } + + [join_id, id_, output_] + } + // | view{"chInitialOutput: ${it.take(3)}"} + + // join the output [prev_id, new_id, output] with the previous state [prev_id, state, ...] + def chNewState = safeJoin(chInitialOutput, chRunFiltered, key_) + // input tuple format: [join_id, id, output, prev_state, ...] + // output tuple format: [join_id, id, new_state, ...] + | map{ tup -> + def new_state = workflowArgs.toState(tup.drop(1).take(3)) + tup.take(2) + [new_state] + tup.drop(4) + } + + if (workflowArgs.auto.publish == "state") { + def chPublish = chNewState + // input tuple format: [join_id, id, new_state, ...] + // output tuple format: [join_id, id, new_state] + | map{ tup -> + tup.take(3) + } + + safeJoin(chPublish, chArgsWithDefaults, key_) + // input tuple format: [join_id, id, new_state, orig_state, ...] + // output tuple format: [id, new_state, orig_state] + | map { tup -> + tup.drop(1).take(3) + } + | publishStatesByConfig(key: key_, config: meta.config) + } + + // remove join_id and meta + chReturn = chNewState + | map { tup -> + // input tuple format: [join_id, id, new_state, ...] + // output tuple format: [id, new_state, ...] + tup.drop(1) + } + | _debug(workflowArgs, "output") + | concat(chPassthrough) + + emit: chReturn + } + + def wf = workflowInstance.cloneWithName(key_) + + // add factory function + wf.metaClass.run = { runArgs -> + workflowFactory(runArgs, workflowArgs, meta) + } + // add config to module for later introspection + wf.metaClass.config = meta.config + + return wf +} + +nextflow.enable.dsl=2 + +// START COMPONENT-SPECIFIC CODE + +// create meta object +meta = [ + "resources_dir": moduleDir.toRealPath().normalize(), + "config": processConfig(readJsonBlob('''{ + "name" : "agat_convert_genscan2gff", + "namespace" : "agat", + "version" : "main", + "authors" : [ + { + "name" : "Leïla Paquay", + "roles" : [ + "author", + "maintainer" + ], + "info" : { + "links" : { + "email" : "leila@data-intuitive.com", + "github" : "Leila011", + "linkedin" : "leilapaquay" + }, + "organizations" : [ + { + "name" : "Data Intuitive", + "href" : "https://www.data-intuitive.com", + "role" : "Software Developer" + } + ] + } + } + ], + "argument_groups" : [ + { + "name" : "Inputs", + "arguments" : [ + { + "type" : "file", + "name" : "--genscan", + "alternatives" : [ + "-g" + ], + "description" : "Input genscan bed file that will be converted.", + "must_exist" : true, + "create_parent" : true, + "required" : true, + "direction" : "input", + "multiple" : false, + "multiple_sep" : ";" + } + ] + }, + { + "name" : "Outputs", + "arguments" : [ + { + "type" : "file", + "name" : "--output", + "alternatives" : [ + "-o", + "--out", + "--outfile", + "--gff" + ], + "description" : "Output GFF file. If no output file is specified, the output will be written to STDOUT.", + "example" : [ + "output.gff" + ], + "must_exist" : true, + "create_parent" : true, + "required" : true, + "direction" : "output", + "multiple" : false, + "multiple_sep" : ";" + } + ] + }, + { + "name" : "Arguments", + "arguments" : [ + { + "type" : "string", + "name" : "--source", + "description" : "The source informs about the tool used to produce the data and is stored in 2nd field of a gff file. Example: Stringtie, Maker, Augustus, etc. [default: data]\n", + "example" : [ + "Stringtie" + ], + "required" : false, + "direction" : "input", + "multiple" : false, + "multiple_sep" : ";" + }, + { + "type" : "string", + "name" : "--primary_tag", + "description" : "The primary_tag corresponds to the data type and is stored in 3rd field of a gff file. Example: gene, mRNA, CDS, etc. [default: gene]\n", + "example" : [ + "gene" + ], + "required" : false, + "direction" : "input", + "multiple" : false, + "multiple_sep" : ";" + }, + { + "type" : "string", + "name" : "--inflate_type", + "description" : "Feature type (3rd column in gff) created when inflate parameter activated [default: exon].\n", + "example" : [ + "exon" + ], + "required" : false, + "direction" : "input", + "multiple" : false, + "multiple_sep" : ";" + }, + { + "type" : "boolean_true", + "name" : "--verbose", + "description" : "add verbosity", + "direction" : "input" + }, + { + "type" : "file", + "name" : "--config", + "alternatives" : [ + "-c" + ], + "description" : "AGAT config file. By default AGAT takes the original agat_config.yaml shipped with AGAT. The `--config` option gives you the possibility to use your own AGAT config file (located elsewhere or named differently).\n", + "example" : [ + "custom_agat_config.yaml" + ], + "must_exist" : true, + "create_parent" : true, + "required" : false, + "direction" : "input", + "multiple" : false, + "multiple_sep" : ";" + } + ] + } + ], + "resources" : [ + { + "type" : "bash_script", + "path" : "script.sh", + "is_executable" : true + } + ], + "description" : "The script takes a GENSCAN file as input, and will translate it in gff\nformat. The GENSCAN format is described [here](http://genome.crg.es/courses/Bioinformatics2003_genefinding/results/genscan.html).\n\n**Known problem** \n\nYou must have submited only DNA sequence, without any header!! Indeed the tool expects only DNA\nsequences and does not crash/warn if an header is submited along the\nsequence. e.g If you have an header \\">seq\\" s-e-q are seen as the 3 first\nnucleotides of the sequence. Then all prediction location are shifted\naccordingly. (checked only on the [online version](http://argonaute.mit.edu/GENSCAN.html). \nI don't know if there is the same problem elsewhere.)\n", + "test_resources" : [ + { + "type" : "bash_script", + "path" : "test.sh", + "is_executable" : true + }, + { + "type" : "file", + "path" : "test_data" + } + ], + "status" : "enabled", + "requirements" : { + "commands" : [ + "ps" + ] + }, + "keywords" : [ + "gene annotations", + "GFF conversion", + "GENSCAN" + ], + "license" : "GPL-3.0", + "references" : { + "doi" : [ + "10.5281/zenodo.3552717" + ] + }, + "links" : { + "repository" : "https://github.com/NBISweden/AGAT", + "homepage" : "https://github.com/NBISweden/AGAT", + "documentation" : "https://agat.readthedocs.io/en/latest/tools/agat_convert_genscan2gff.html", + "issue_tracker" : "https://github.com/NBISweden/AGAT/issues" + }, + "runners" : [ + { + "type" : "executable", + "id" : "executable", + "docker_setup_strategy" : "ifneedbepullelsecachedbuild" + }, + { + "type" : "nextflow", + "id" : "nextflow", + "directives" : { + "tag" : "$id" + }, + "auto" : { + "simplifyInput" : true, + "simplifyOutput" : false, + "transcript" : false, + "publish" : false + }, + "config" : { + "labels" : { + "mem1gb" : "memory = 1000000000.B", + "mem2gb" : "memory = 2000000000.B", + "mem5gb" : "memory = 5000000000.B", + "mem10gb" : "memory = 10000000000.B", + "mem20gb" : "memory = 20000000000.B", + "mem50gb" : "memory = 50000000000.B", + "mem100gb" : "memory = 100000000000.B", + "mem200gb" : "memory = 200000000000.B", + "mem500gb" : "memory = 500000000000.B", + "mem1tb" : "memory = 1000000000000.B", + "mem2tb" : "memory = 2000000000000.B", + "mem5tb" : "memory = 5000000000000.B", + "mem10tb" : "memory = 10000000000000.B", + "mem20tb" : "memory = 20000000000000.B", + "mem50tb" : "memory = 50000000000000.B", + "mem100tb" : "memory = 100000000000000.B", + "mem200tb" : "memory = 200000000000000.B", + "mem500tb" : "memory = 500000000000000.B", + "mem1gib" : "memory = 1073741824.B", + "mem2gib" : "memory = 2147483648.B", + "mem4gib" : "memory = 4294967296.B", + "mem8gib" : "memory = 8589934592.B", + "mem16gib" : "memory = 17179869184.B", + "mem32gib" : "memory = 34359738368.B", + "mem64gib" : "memory = 68719476736.B", + "mem128gib" : "memory = 137438953472.B", + "mem256gib" : "memory = 274877906944.B", + "mem512gib" : "memory = 549755813888.B", + "mem1tib" : "memory = 1099511627776.B", + "mem2tib" : "memory = 2199023255552.B", + "mem4tib" : "memory = 4398046511104.B", + "mem8tib" : "memory = 8796093022208.B", + "mem16tib" : "memory = 17592186044416.B", + "mem32tib" : "memory = 35184372088832.B", + "mem64tib" : "memory = 70368744177664.B", + "mem128tib" : "memory = 140737488355328.B", + "mem256tib" : "memory = 281474976710656.B", + "mem512tib" : "memory = 562949953421312.B", + "cpu1" : "cpus = 1", + "cpu2" : "cpus = 2", + "cpu5" : "cpus = 5", + "cpu10" : "cpus = 10", + "cpu20" : "cpus = 20", + "cpu50" : "cpus = 50", + "cpu100" : "cpus = 100", + "cpu200" : "cpus = 200", + "cpu500" : "cpus = 500", + "cpu1000" : "cpus = 1000" + } + }, + "debug" : false, + "container" : "docker" + } + ], + "engines" : [ + { + "type" : "docker", + "id" : "docker", + "image" : "quay.io/biocontainers/agat:1.4.0--pl5321hdfd78af_0", + "target_registry" : "images.viash-hub.com", + "target_tag" : "main", + "namespace_separator" : "/", + "setup" : [ + { + "type" : "docker", + "run" : [ + "agat --version | sed 's/AGAT\\\\s\\\\(.*\\\\)/agat: \\"\\\\1\\"/' > /var/software_versions.txt\n" + ] + } + ] + }, + { + "type" : "native", + "id" : "native" + } + ], + "build_info" : { + "config" : "/workdir/root/repo/src/agat/agat_convert_genscan2gff/config.vsh.yaml", + "runner" : "nextflow", + "engine" : "docker|native", + "output" : "target/nextflow/agat/agat_convert_genscan2gff", + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" + }, + "package_config" : { + "name" : "biobox", + "version" : "main", + "description" : "A collection of bioinformatics tools for working with sequence data.\n", + "viash_version" : "0.9.0", + "source" : "src", + "target" : "target", + "config_mods" : [ + ".requirements.commands := ['ps']\n", + ".engines += { type: \\"native\\" }", + ".engines[.type == 'docker'].target_registry := 'images.viash-hub.com'", + ".engines[.type == 'docker'].target_tag := 'main'" + ], + "keywords" : [ + "bioinformatics", + "modules", + "sequencing" + ], + "license" : "MIT", + "organization" : "vsh", + "links" : { + "repository" : "https://github.com/viash-hub/biobox", + "issue_tracker" : "https://github.com/viash-hub/biobox/issues" + } + } +}''')) +] + +// resolve dependencies dependencies (if any) + + +// inner workflow +// inner workflow hook +def innerWorkflowFactory(args) { + def rawScript = '''set -e +tempscript=".viash_script.sh" +cat > "$tempscript" << VIASHMAIN +#!/bin/bash + +set -eo pipefail + +## VIASH START +# The following code has been auto-generated by Viash. +$( if [ ! -z ${VIASH_PAR_GENSCAN+x} ]; then echo "${VIASH_PAR_GENSCAN}" | sed "s#'#'\\"'\\"'#g;s#.*#par_genscan='&'#" ; else echo "# par_genscan="; fi ) +$( if [ ! -z ${VIASH_PAR_OUTPUT+x} ]; then echo "${VIASH_PAR_OUTPUT}" | sed "s#'#'\\"'\\"'#g;s#.*#par_output='&'#" ; else echo "# par_output="; fi ) +$( if [ ! -z ${VIASH_PAR_SOURCE+x} ]; then echo "${VIASH_PAR_SOURCE}" | sed "s#'#'\\"'\\"'#g;s#.*#par_source='&'#" ; else echo "# par_source="; fi ) +$( if [ ! -z ${VIASH_PAR_PRIMARY_TAG+x} ]; then echo "${VIASH_PAR_PRIMARY_TAG}" | sed "s#'#'\\"'\\"'#g;s#.*#par_primary_tag='&'#" ; else echo "# par_primary_tag="; fi ) +$( if [ ! -z ${VIASH_PAR_INFLATE_TYPE+x} ]; then echo "${VIASH_PAR_INFLATE_TYPE}" | sed "s#'#'\\"'\\"'#g;s#.*#par_inflate_type='&'#" ; else echo "# par_inflate_type="; fi ) +$( if [ ! -z ${VIASH_PAR_VERBOSE+x} ]; then echo "${VIASH_PAR_VERBOSE}" | sed "s#'#'\\"'\\"'#g;s#.*#par_verbose='&'#" ; else echo "# par_verbose="; fi ) +$( if [ ! -z ${VIASH_PAR_CONFIG+x} ]; then echo "${VIASH_PAR_CONFIG}" | sed "s#'#'\\"'\\"'#g;s#.*#par_config='&'#" ; else echo "# par_config="; fi ) +$( if [ ! -z ${VIASH_META_NAME+x} ]; then echo "${VIASH_META_NAME}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_name='&'#" ; else echo "# meta_name="; fi ) +$( if [ ! -z ${VIASH_META_FUNCTIONALITY_NAME+x} ]; then echo "${VIASH_META_FUNCTIONALITY_NAME}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_functionality_name='&'#" ; else echo "# meta_functionality_name="; fi ) +$( if [ ! -z ${VIASH_META_RESOURCES_DIR+x} ]; then echo "${VIASH_META_RESOURCES_DIR}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_resources_dir='&'#" ; else echo "# meta_resources_dir="; fi ) +$( if [ ! -z ${VIASH_META_EXECUTABLE+x} ]; then echo "${VIASH_META_EXECUTABLE}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_executable='&'#" ; else echo "# meta_executable="; fi ) +$( if [ ! -z ${VIASH_META_CONFIG+x} ]; then echo "${VIASH_META_CONFIG}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_config='&'#" ; else echo "# meta_config="; fi ) +$( if [ ! -z ${VIASH_META_TEMP_DIR+x} ]; then echo "${VIASH_META_TEMP_DIR}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_temp_dir='&'#" ; else echo "# meta_temp_dir="; fi ) +$( if [ ! -z ${VIASH_META_CPUS+x} ]; then echo "${VIASH_META_CPUS}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_cpus='&'#" ; else echo "# meta_cpus="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_B+x} ]; then echo "${VIASH_META_MEMORY_B}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_b='&'#" ; else echo "# meta_memory_b="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_KB+x} ]; then echo "${VIASH_META_MEMORY_KB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_kb='&'#" ; else echo "# meta_memory_kb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_MB+x} ]; then echo "${VIASH_META_MEMORY_MB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_mb='&'#" ; else echo "# meta_memory_mb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_GB+x} ]; then echo "${VIASH_META_MEMORY_GB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_gb='&'#" ; else echo "# meta_memory_gb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_TB+x} ]; then echo "${VIASH_META_MEMORY_TB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_tb='&'#" ; else echo "# meta_memory_tb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_PB+x} ]; then echo "${VIASH_META_MEMORY_PB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_pb='&'#" ; else echo "# meta_memory_pb="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_KIB+x} ]; then echo "${VIASH_META_MEMORY_KIB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_kib='&'#" ; else echo "# meta_memory_kib="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_MIB+x} ]; then echo "${VIASH_META_MEMORY_MIB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_mib='&'#" ; else echo "# meta_memory_mib="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_GIB+x} ]; then echo "${VIASH_META_MEMORY_GIB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_gib='&'#" ; else echo "# meta_memory_gib="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_TIB+x} ]; then echo "${VIASH_META_MEMORY_TIB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_tib='&'#" ; else echo "# meta_memory_tib="; fi ) +$( if [ ! -z ${VIASH_META_MEMORY_PIB+x} ]; then echo "${VIASH_META_MEMORY_PIB}" | sed "s#'#'\\"'\\"'#g;s#.*#meta_memory_pib='&'#" ; else echo "# meta_memory_pib="; fi ) + +## VIASH END + +# unset flags +[[ "\\$par_inflate_off" == "true" ]] && unset par_inflate_off +[[ "\\$par_verbose" == "false" ]] && unset par_verbose + +# run agat_convert_genscan2gff +agat_convert_genscan2gff.pl \\\\ + --genscan "\\$par_genscan" \\\\ + --output "\\$par_output" \\\\ + \\${par_source:+--source "\\${par_source}"} \\\\ + \\${par_primary_tag:+--primary_tag "\\${par_primary_tag}"} \\\\ + \\${par_inflate_off:+--inflate_off} \\\\ + \\${par_inflate_type:+--inflate_type "\\${par_inflate_type}"} \\\\ + \\${par_verbose:+--verbose} \\\\ + \\${par_config:+--config "\\${par_config}"} +VIASHMAIN +bash "$tempscript" +''' + + return vdsl3WorkflowFactory(args, meta, rawScript) +} + + + +/** + * Generate a workflow for VDSL3 modules. + * + * This function is called by the workflowFactory() function. + * + * Input channel: [id, input_map] + * Output channel: [id, output_map] + * + * Internally, this workflow will convert the input channel + * to a format which the Nextflow module will be able to handle. + */ +def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { + def key = args["key"] + def processObj = null + + workflow processWf { + take: input_ + main: + + if (processObj == null) { + processObj = _vdsl3ProcessFactory(args, meta, rawScript) + } + + output_ = input_ + | map { tuple -> + def id = tuple[0] + def data_ = tuple[1] + + if (workflow.stubRun) { + // add id if missing + data_ = [id: 'stub'] + data_ + } + + // process input files separately + def inputPaths = meta.config.allArguments + .findAll { it.type == "file" && it.direction == "input" } + .collect { par -> + def val = data_.containsKey(par.plainName) ? data_[par.plainName] : [] + def inputFiles = [] + if (val == null) { + inputFiles = [] + } else if (val instanceof List) { + inputFiles = val + } else if (val instanceof Path) { + inputFiles = [ val ] + } else { + inputFiles = [] + } + if (!workflow.stubRun) { + // throw error when an input file doesn't exist + inputFiles.each{ file -> + assert file.exists() : + "Error in module '${key}' id '${id}' argument '${par.plainName}'.\n" + + " Required input file does not exist.\n" + + " Path: '$file'.\n" + + " Expected input file to exist" + } + } + inputFiles + } + + // remove input files + def argsExclInputFiles = meta.config.allArguments + .findAll { (it.type != "file" || it.direction != "input") && data_.containsKey(it.plainName) } + .collectEntries { par -> + def parName = par.plainName + def val = data_[parName] + if (par.multiple && val instanceof Collection) { + val = val.join(par.multiple_sep) + } + if (par.direction == "output" && par.type == "file") { + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) + } + [parName, val] + } + + [ id ] + inputPaths + [ argsExclInputFiles, meta.resources_dir ] + } + | processObj + | map { output -> + def outputFiles = meta.config.allArguments + .findAll { it.type == "file" && it.direction == "output" } + .indexed() + .collectEntries{ index, par -> + def out = output[index + 1] + // strip dummy '.exitcode' file from output (see nextflow-io/nextflow#2678) + if (!out instanceof List || out.size() <= 1) { + if (par.multiple) { + out = [] + } else { + assert !par.required : + "Error in module '${key}' id '${output[0]}' argument '${par.plainName}'.\n" + + " Required output file is missing" + out = null + } + } else if (out.size() == 2 && !par.multiple) { + out = out[1] + } else { + out = out.drop(1) + } + [ par.plainName, out ] + } + + // drop null outputs + outputFiles.removeAll{it.value == null} + + [ output[0], outputFiles ] + } + emit: output_ + } + + return processWf +} + +// depends on: session? +def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { + // autodetect process key + def wfKey = workflowArgs["key"] + def procKeyPrefix = "${wfKey}_process" + def scriptMeta = nextflow.script.ScriptMeta.current() + def existing = scriptMeta.getProcessNames().findAll{it.startsWith(procKeyPrefix)} + def numbers = existing.collect{it.replace(procKeyPrefix, "0").toInteger()} + def newNumber = (numbers + [-1]).max() + 1 + + def procKey = newNumber == 0 ? procKeyPrefix : "$procKeyPrefix$newNumber" + + if (newNumber > 0) { + log.warn "Key for module '${wfKey}' is duplicated.\n", + "If you run a component multiple times in the same workflow,\n" + + "it's recommended you set a unique key for every call,\n" + + "for example: ${wfKey}.run(key: \"foo\")." + } + + // subset directives and convert to list of tuples + def drctv = workflowArgs.directives + + // TODO: unit test the two commands below + // convert publish array into tags + def valueToStr = { val -> + // ignore closures + if (val instanceof CharSequence) { + if (!val.matches('^[{].*[}]$')) { + '"' + val + '"' + } else { + val + } + } else if (val instanceof List) { + "[" + val.collect{valueToStr(it)}.join(", ") + "]" + } else if (val instanceof Map) { + "[" + val.collect{k, v -> k + ": " + valueToStr(v)}.join(", ") + "]" + } else { + val.inspect() + } + } + + // multiple entries allowed: label, publishdir + def drctvStrs = drctv.collect { key, value -> + if (key in ["label", "publishDir"]) { + value.collect{ val -> + if (val instanceof Map) { + "\n$key " + val.collect{ k, v -> k + ": " + valueToStr(v) }.join(", ") + } else if (val == null) { + "" + } else { + "\n$key " + valueToStr(val) + } + }.join() + } else if (value instanceof Map) { + "\n$key " + value.collect{ k, v -> k + ": " + valueToStr(v) }.join(", ") + } else { + "\n$key " + valueToStr(value) + } + }.join() + + def inputPaths = meta.config.allArguments + .findAll { it.type == "file" && it.direction == "input" } + .collect { ', path(viash_par_' + it.plainName + ', stageAs: "_viash_par/' + it.plainName + '_?/*")' } + .join() + + def outputPaths = meta.config.allArguments + .findAll { it.type == "file" && it.direction == "output" } + .collect { par -> + // insert dummy into every output (see nextflow-io/nextflow#2678) + if (!par.multiple) { + ', path{[".exitcode", args.' + par.plainName + ']}' + } else { + ', path{[".exitcode"] + args.' + par.plainName + '}' + } + } + .join() + + // TODO: move this functionality somewhere else? + if (workflowArgs.auto.transcript) { + outputPaths = outputPaths + ', path{[".exitcode", ".command*"]}' + } else { + outputPaths = outputPaths + ', path{[".exitcode"]}' + } + + // create dirs for output files (based on BashWrapper.createParentFiles) + def createParentStr = meta.config.allArguments + .findAll { it.type == "file" && it.direction == "output" && it.create_parent } + .collect { par -> + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" + } + .join("\n") + + // construct inputFileExports + def inputFileExports = meta.config.allArguments + .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } + .collect { par -> + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" + } + + // NOTE: if using docker, use /tmp instead of tmpDir! + def tmpDir = java.nio.file.Paths.get( + System.getenv('NXF_TEMP') ?: + System.getenv('VIASH_TEMP') ?: + System.getenv('VIASH_TMPDIR') ?: + System.getenv('VIASH_TEMPDIR') ?: + System.getenv('VIASH_TMP') ?: + System.getenv('TEMP') ?: + System.getenv('TMPDIR') ?: + System.getenv('TEMPDIR') ?: + System.getenv('TMP') ?: + '/tmp' + ).toAbsolutePath() + + // construct stub + def stub = meta.config.allArguments + .findAll { it.type == "file" && it.direction == "output" } + .collect { par -> + "\${ args.containsKey(\"${par.plainName}\") ? \"touch2 \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"].replace(\"_*\", \"_0\") : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + } + .join("\n") + + // escape script + def escapedScript = rawScript.replace('\\', '\\\\').replace('$', '\\$').replace('"""', '\\"\\"\\"') + + // publishdir assert + def assertStr = (workflowArgs.auto.publish == true) || workflowArgs.auto.transcript ? + """\nassert task.publishDir.size() > 0: "if auto.publish is true, params.publish_dir needs to be defined.\\n Example: --publish_dir './output/'" """ : + "" + + // generate process string + def procStr = + """nextflow.enable.dsl=2 + | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } + |process $procKey {$drctvStrs + |input: + | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") + |output: + | tuple val("\$id")$outputPaths, optional: true + |stub: + |\"\"\" + |touch2() { mkdir -p "\\\$(dirname "\\\$1")" && touch "\\\$1" ; } + |$stub + |\"\"\" + |script:$assertStr + |def parInject = args + | .findAll{key, value -> value != null} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} + | .join("\\n") + |\"\"\" + |# meta exports + |export VIASH_META_RESOURCES_DIR="\${resourcesDir}" + |export VIASH_META_TEMP_DIR="${['docker', 'podman', 'charliecloud'].any{ it == workflow.containerEngine } ? '/tmp' : tmpDir}" + |export VIASH_META_NAME="${meta.config.name}" + |# export VIASH_META_EXECUTABLE="\\\$VIASH_META_RESOURCES_DIR/\\\$VIASH_META_NAME" + |export VIASH_META_CONFIG="\\\$VIASH_META_RESOURCES_DIR/.config.vsh.yaml" + |\${task.cpus ? "export VIASH_META_CPUS=\$task.cpus" : "" } + |\${task.memory?.bytes != null ? "export VIASH_META_MEMORY_B=\$task.memory.bytes" : "" } + |if [ ! -z \\\${VIASH_META_MEMORY_B+x} ]; then + | export VIASH_META_MEMORY_KB=\\\$(( (\\\$VIASH_META_MEMORY_B+999) / 1000 )) + | export VIASH_META_MEMORY_MB=\\\$(( (\\\$VIASH_META_MEMORY_KB+999) / 1000 )) + | export VIASH_META_MEMORY_GB=\\\$(( (\\\$VIASH_META_MEMORY_MB+999) / 1000 )) + | export VIASH_META_MEMORY_TB=\\\$(( (\\\$VIASH_META_MEMORY_GB+999) / 1000 )) + | export VIASH_META_MEMORY_PB=\\\$(( (\\\$VIASH_META_MEMORY_TB+999) / 1000 )) + | export VIASH_META_MEMORY_KIB=\\\$(( (\\\$VIASH_META_MEMORY_B+1023) / 1024 )) + | export VIASH_META_MEMORY_MIB=\\\$(( (\\\$VIASH_META_MEMORY_KIB+1023) / 1024 )) + | export VIASH_META_MEMORY_GIB=\\\$(( (\\\$VIASH_META_MEMORY_MIB+1023) / 1024 )) + | export VIASH_META_MEMORY_TIB=\\\$(( (\\\$VIASH_META_MEMORY_GIB+1023) / 1024 )) + | export VIASH_META_MEMORY_PIB=\\\$(( (\\\$VIASH_META_MEMORY_TIB+1023) / 1024 )) + |fi + | + |# meta synonyms + |export VIASH_TEMP="\\\$VIASH_META_TEMP_DIR" + |export TEMP_DIR="\\\$VIASH_META_TEMP_DIR" + | + |# create output dirs if need be + |function mkdir_parent { + | for file in "\\\$@"; do + | mkdir -p "\\\$(dirname "\\\$file")" + | done + |} + |$createParentStr + | + |# argument exports${inputFileExports.join()} + |\$parInject + | + |# process script + |${escapedScript} + |\"\"\" + |} + |""".stripMargin() + + // TODO: print on debug + // if (workflowArgs.debug == true) { + // println("######################\n$procStr\n######################") + // } + + // write process to temp file + def tempFile = java.nio.file.Files.createTempFile("viash-process-${procKey}-", ".nf") + addShutdownHook { java.nio.file.Files.deleteIfExists(tempFile) } + tempFile.text = procStr + + // create process from temp file + def binding = new nextflow.script.ScriptBinding([:]) + def session = nextflow.Nextflow.getSession() + def parser = new nextflow.script.ScriptParser(session) + .setModule(true) + .setBinding(binding) + def moduleScript = parser.runScript(tempFile) + .getScript() + + // register module in meta + def module = new nextflow.script.IncludeDef.Module(name: procKey) + scriptMeta.addModule(moduleScript, module.name, module.alias) + + // retrieve and return process from meta + return scriptMeta.getProcess(procKey) +} + +// defaults +meta["defaults"] = [ + // key to be used to trace the process and determine output names + key: null, + + // fixed arguments to be passed to script + args: [:], + + // default directives + directives: readJsonBlob('''{ + "container" : { + "registry" : "images.viash-hub.com", + "image" : "vsh/biobox/agat/agat_convert_genscan2gff", + "tag" : "main" + }, + "tag" : "$id" +}'''), + + // auto settings + auto: readJsonBlob('''{ + "simplifyInput" : true, + "simplifyOutput" : false, + "transcript" : false, + "publish" : false +}'''), + + // Apply a map over the incoming tuple + // Example: `{ tup -> [ tup[0], [input: tup[1].output] ] + tup.drop(2) }` + map: null, + + // Apply a map over the ID element of a tuple (i.e. the first element) + // Example: `{ id -> id + "_foo" }` + mapId: null, + + // Apply a map over the data element of a tuple (i.e. the second element) + // Example: `{ data -> [ input: data.output ] }` + mapData: null, + + // Apply a map over the passthrough elements of a tuple (i.e. the tuple excl. the first two elements) + // Example: `{ pt -> pt.drop(1) }` + mapPassthrough: null, + + // Filter the channel + // Example: `{ tup -> tup[0] == "foo" }` + filter: null, + + // Choose whether or not to run the component on the tuple if the condition is true. + // Otherwise, the tuple will be passed through. + // Example: `{ tup -> tup[0] != "skip_this" }` + runIf: null, + + // Rename keys in the data field of the tuple (i.e. the second element) + // Will likely be deprecated in favour of `fromState`. + // Example: `[ "new_key": "old_key" ]` + renameKeys: null, + + // Fetch data from the state and pass it to the module without altering the current state. + // + // `fromState` should be `null`, `List[String]`, `Map[String, String]` or a function. + // + // - If it is `null`, the state will be passed to the module as is. + // - If it is a `List[String]`, the data will be the values of the state at the given keys. + // - If it is a `Map[String, String]`, the data will be the values of the state at the given keys, with the keys renamed according to the map. + // - If it is a function, the tuple (`[id, state]`) in the channel will be passed to the function, and the result will be used as the data. + // + // Example: `{ id, state -> [input: state.fastq_file] }` + // Default: `null` + fromState: null, + + // Determine how the state should be updated after the module has been run. + // + // `toState` should be `null`, `List[String]`, `Map[String, String]` or a function. + // + // - If it is `null`, the state will be replaced with the output of the module. + // - If it is a `List[String]`, the state will be updated with the values of the data at the given keys. + // - If it is a `Map[String, String]`, the state will be updated with the values of the data at the given keys, with the keys renamed according to the map. + // - If it is a function, a tuple (`[id, output, state]`) will be passed to the function, and the result will be used as the new state. + // + // Example: `{ id, output, state -> state + [counts: state.output] }` + // Default: `{ id, output, state -> output }` + toState: null, + + // Whether or not to print debug messages + // Default: `false` + debug: false +] + +// initialise default workflow +meta["workflow"] = workflowFactory([key: meta.config.name], meta.defaults, meta) + +// add workflow to environment +nextflow.script.ScriptMeta.current().addDefinition(meta.workflow) + +// anonymous workflow for running this module as a standalone +workflow { + // add id argument if it's not already in the config + // TODO: deep copy + def newConfig = deepClone(meta.config) + def newParams = deepClone(params) + + def argsContainsId = newConfig.allArguments.any{it.plainName == "id"} + if (!argsContainsId) { + def idArg = [ + 'name': '--id', + 'required': false, + 'type': 'string', + 'description': 'A unique id for every entry.', + 'multiple': false + ] + newConfig.arguments.add(0, idArg) + newConfig = processConfig(newConfig) + } + if (!newParams.containsKey("id")) { + newParams.id = "run" + } + + helpMessage(newConfig) + + channelFromParams(newParams, newConfig) + // make sure id is not in the state if id is not in the args + | map {id, state -> + if (!argsContainsId) { + [id, state.findAll{k, v -> k != "id"}] + } else { + [id, state] + } + } + | meta.workflow.run( + auto: [ publish: "state" ] + ) +} + +// END COMPONENT-SPECIFIC CODE diff --git a/target/nextflow/agat/agat_convert_genscan2gff/nextflow.config b/target/nextflow/agat/agat_convert_genscan2gff/nextflow.config new file mode 100644 index 00000000..f5bb8fe2 --- /dev/null +++ b/target/nextflow/agat/agat_convert_genscan2gff/nextflow.config @@ -0,0 +1,126 @@ +manifest { + name = 'agat/agat_convert_genscan2gff' + mainScript = 'main.nf' + nextflowVersion = '!>=20.12.1-edge' + version = 'main' + description = 'The script takes a GENSCAN file as input, and will translate it in gff\nformat. The GENSCAN format is described [here](http://genome.crg.es/courses/Bioinformatics2003_genefinding/results/genscan.html).\n\n**Known problem** \n\nYou must have submited only DNA sequence, without any header!! Indeed the tool expects only DNA\nsequences and does not crash/warn if an header is submited along the\nsequence. e.g If you have an header ">seq" s-e-q are seen as the 3 first\nnucleotides of the sequence. Then all prediction location are shifted\naccordingly. (checked only on the [online version](http://argonaute.mit.edu/GENSCAN.html). \nI don\'t know if there is the same problem elsewhere.)\n' + author = 'Leïla Paquay' +} + +process.container = 'nextflow/bash:latest' + +// detect tempdir +tempDir = java.nio.file.Paths.get( + System.getenv('NXF_TEMP') ?: + System.getenv('VIASH_TEMP') ?: + System.getenv('TEMPDIR') ?: + System.getenv('TMPDIR') ?: + '/tmp' +).toAbsolutePath() + +profiles { + no_publish { + process { + withName: '.*' { + publishDir = [ + enabled: false + ] + } + } + } + mount_temp { + docker.temp = tempDir + podman.temp = tempDir + charliecloud.temp = tempDir + } + docker { + docker.enabled = true + // docker.userEmulation = true + singularity.enabled = false + podman.enabled = false + shifter.enabled = false + charliecloud.enabled = false + } + singularity { + singularity.enabled = true + singularity.autoMounts = true + docker.enabled = false + podman.enabled = false + shifter.enabled = false + charliecloud.enabled = false + } + podman { + podman.enabled = true + docker.enabled = false + singularity.enabled = false + shifter.enabled = false + charliecloud.enabled = false + } + shifter { + shifter.enabled = true + docker.enabled = false + singularity.enabled = false + podman.enabled = false + charliecloud.enabled = false + } + charliecloud { + charliecloud.enabled = true + docker.enabled = false + singularity.enabled = false + podman.enabled = false + shifter.enabled = false + } +} + +process{ + withLabel: mem1gb { memory = 1000000000.B } + withLabel: mem2gb { memory = 2000000000.B } + withLabel: mem5gb { memory = 5000000000.B } + withLabel: mem10gb { memory = 10000000000.B } + withLabel: mem20gb { memory = 20000000000.B } + withLabel: mem50gb { memory = 50000000000.B } + withLabel: mem100gb { memory = 100000000000.B } + withLabel: mem200gb { memory = 200000000000.B } + withLabel: mem500gb { memory = 500000000000.B } + withLabel: mem1tb { memory = 1000000000000.B } + withLabel: mem2tb { memory = 2000000000000.B } + withLabel: mem5tb { memory = 5000000000000.B } + withLabel: mem10tb { memory = 10000000000000.B } + withLabel: mem20tb { memory = 20000000000000.B } + withLabel: mem50tb { memory = 50000000000000.B } + withLabel: mem100tb { memory = 100000000000000.B } + withLabel: mem200tb { memory = 200000000000000.B } + withLabel: mem500tb { memory = 500000000000000.B } + withLabel: mem1gib { memory = 1073741824.B } + withLabel: mem2gib { memory = 2147483648.B } + withLabel: mem4gib { memory = 4294967296.B } + withLabel: mem8gib { memory = 8589934592.B } + withLabel: mem16gib { memory = 17179869184.B } + withLabel: mem32gib { memory = 34359738368.B } + withLabel: mem64gib { memory = 68719476736.B } + withLabel: mem128gib { memory = 137438953472.B } + withLabel: mem256gib { memory = 274877906944.B } + withLabel: mem512gib { memory = 549755813888.B } + withLabel: mem1tib { memory = 1099511627776.B } + withLabel: mem2tib { memory = 2199023255552.B } + withLabel: mem4tib { memory = 4398046511104.B } + withLabel: mem8tib { memory = 8796093022208.B } + withLabel: mem16tib { memory = 17592186044416.B } + withLabel: mem32tib { memory = 35184372088832.B } + withLabel: mem64tib { memory = 70368744177664.B } + withLabel: mem128tib { memory = 140737488355328.B } + withLabel: mem256tib { memory = 281474976710656.B } + withLabel: mem512tib { memory = 562949953421312.B } + withLabel: cpu1 { cpus = 1 } + withLabel: cpu2 { cpus = 2 } + withLabel: cpu5 { cpus = 5 } + withLabel: cpu10 { cpus = 10 } + withLabel: cpu20 { cpus = 20 } + withLabel: cpu50 { cpus = 50 } + withLabel: cpu100 { cpus = 100 } + withLabel: cpu200 { cpus = 200 } + withLabel: cpu500 { cpus = 500 } + withLabel: cpu1000 { cpus = 1000 } +} + + diff --git a/target/nextflow/agat/agat_convert_genscan2gff/nextflow_schema.json b/target/nextflow/agat/agat_convert_genscan2gff/nextflow_schema.json new file mode 100644 index 00000000..4f8d9ed3 --- /dev/null +++ b/target/nextflow/agat/agat_convert_genscan2gff/nextflow_schema.json @@ -0,0 +1,160 @@ +{ +"$schema": "http://json-schema.org/draft-07/schema", +"title": "agat_convert_genscan2gff", +"description": "The script takes a GENSCAN file as input, and will translate it in gff\nformat. The GENSCAN format is described [here](http://genome.crg.es/courses/Bioinformatics2003_genefinding/results/genscan.html).\n\n**Known problem** \n\nYou must have submited only DNA sequence, without any header!! Indeed the tool expects only DNA\nsequences and does not crash/warn if an header is submited along the\nsequence. e.g If you have an header \"\u003eseq\" s-e-q are seen as the 3 first\nnucleotides of the sequence. Then all prediction location are shifted\naccordingly. (checked only on the [online version](http://argonaute.mit.edu/GENSCAN.html). \nI don\u0027t know if there is the same problem elsewhere.)\n", +"type": "object", +"definitions": { + + + + "inputs" : { + "title": "Inputs", + "type": "object", + "description": "No description", + "properties": { + + + "genscan": { + "type": + "string", + "description": "Type: `file`, required. Input genscan bed file that will be converted", + "help_text": "Type: `file`, required. Input genscan bed file that will be converted." + + } + + +} +}, + + + "outputs" : { + "title": "Outputs", + "type": "object", + "description": "No description", + "properties": { + + + "output": { + "type": + "string", + "description": "Type: `file`, required, default: `$id.$key.output.gff`, example: `output.gff`. Output GFF file", + "help_text": "Type: `file`, required, default: `$id.$key.output.gff`, example: `output.gff`. Output GFF file. If no output file is specified, the output will be written to STDOUT." + , + "default": "$id.$key.output.gff" + } + + +} +}, + + + "arguments" : { + "title": "Arguments", + "type": "object", + "description": "No description", + "properties": { + + + "source": { + "type": + "string", + "description": "Type: `string`, example: `Stringtie`. The source informs about the tool used to produce the data and is stored in 2nd field of a gff file", + "help_text": "Type: `string`, example: `Stringtie`. The source informs about the tool used to produce the data and is stored in 2nd field of a gff file. Example: Stringtie, Maker, Augustus, etc. [default: data]\n" + + } + + + , + "primary_tag": { + "type": + "string", + "description": "Type: `string`, example: `gene`. The primary_tag corresponds to the data type and is stored in 3rd field of a gff file", + "help_text": "Type: `string`, example: `gene`. The primary_tag corresponds to the data type and is stored in 3rd field of a gff file. Example: gene, mRNA, CDS, etc. [default: gene]\n" + + } + + + , + "inflate_type": { + "type": + "string", + "description": "Type: `string`, example: `exon`. Feature type (3rd column in gff) created when inflate parameter activated [default: exon]", + "help_text": "Type: `string`, example: `exon`. Feature type (3rd column in gff) created when inflate parameter activated [default: exon].\n" + + } + + + , + "verbose": { + "type": + "boolean", + "description": "Type: `boolean_true`, default: `false`. add verbosity", + "help_text": "Type: `boolean_true`, default: `false`. add verbosity" + , + "default": "False" + } + + + , + "config": { + "type": + "string", + "description": "Type: `file`, example: `custom_agat_config.yaml`. AGAT config file", + "help_text": "Type: `file`, example: `custom_agat_config.yaml`. AGAT config file. By default AGAT takes the original agat_config.yaml shipped with AGAT. The `--config` option gives you the possibility to use your own AGAT config file (located elsewhere or named differently).\n" + + } + + +} +}, + + + "nextflow input-output arguments" : { + "title": "Nextflow input-output arguments", + "type": "object", + "description": "Input/output parameters for Nextflow itself. Please note that both publishDir and publish_dir are supported but at least one has to be configured.", + "properties": { + + + "publish_dir": { + "type": + "string", + "description": "Type: `string`, required, example: `output/`. Path to an output directory", + "help_text": "Type: `string`, required, example: `output/`. Path to an output directory." + + } + + + , + "param_list": { + "type": + "string", + "description": "Type: `string`, example: `my_params.yaml`. Allows inputting multiple parameter sets to initialise a Nextflow channel", + "help_text": "Type: `string`, example: `my_params.yaml`. Allows inputting multiple parameter sets to initialise a Nextflow channel. A `param_list` can either be a list of maps, a csv file, a json file, a yaml file, or simply a yaml blob.\n\n* A list of maps (as-is) where the keys of each map corresponds to the arguments of the pipeline. Example: in a `nextflow.config` file: `param_list: [ [\u0027id\u0027: \u0027foo\u0027, \u0027input\u0027: \u0027foo.txt\u0027], [\u0027id\u0027: \u0027bar\u0027, \u0027input\u0027: \u0027bar.txt\u0027] ]`.\n* A csv file should have column names which correspond to the different arguments of this pipeline. Example: `--param_list data.csv` with columns `id,input`.\n* A json or a yaml file should be a list of maps, each of which has keys corresponding to the arguments of the pipeline. Example: `--param_list data.json` with contents `[ {\u0027id\u0027: \u0027foo\u0027, \u0027input\u0027: \u0027foo.txt\u0027}, {\u0027id\u0027: \u0027bar\u0027, \u0027input\u0027: \u0027bar.txt\u0027} ]`.\n* A yaml blob can also be passed directly as a string. Example: `--param_list \"[ {\u0027id\u0027: \u0027foo\u0027, \u0027input\u0027: \u0027foo.txt\u0027}, {\u0027id\u0027: \u0027bar\u0027, \u0027input\u0027: \u0027bar.txt\u0027} ]\"`.\n\nWhen passing a csv, json or yaml file, relative path names are relativized to the location of the parameter file. No relativation is performed when `param_list` is a list of maps (as-is) or a yaml blob.", + "hidden": true + + } + + +} +} +}, +"allOf": [ + + { + "$ref": "#/definitions/inputs" + }, + + { + "$ref": "#/definitions/outputs" + }, + + { + "$ref": "#/definitions/arguments" + }, + + { + "$ref": "#/definitions/nextflow input-output arguments" + } +] +} diff --git a/target/nextflow/agat/agat_convert_sp_gff2gtf/.config.vsh.yaml b/target/nextflow/agat/agat_convert_sp_gff2gtf/.config.vsh.yaml index 6907dfd7..1db9dc24 100644 --- a/target/nextflow/agat/agat_convert_sp_gff2gtf/.config.vsh.yaml +++ b/target/nextflow/agat/agat_convert_sp_gff2gtf/.config.vsh.yaml @@ -227,15 +227,16 @@ build_info: engine: "docker|native" output: "target/nextflow/agat/agat_convert_sp_gff2gtf" executable: "target/nextflow/agat/agat_convert_sp_gff2gtf/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/agat/agat_convert_sp_gff2gtf/main.nf b/target/nextflow/agat/agat_convert_sp_gff2gtf/main.nf index 07971fcc..78a437d2 100644 --- a/target/nextflow/agat/agat_convert_sp_gff2gtf/main.nf +++ b/target/nextflow/agat/agat_convert_sp_gff2gtf/main.nf @@ -1,8 +1,8 @@ // agat_convert_sp_gff2gtf main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3061,15 +3067,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/agat/agat_convert_sp_gff2gtf", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3216,7 +3223,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3347,7 +3358,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3355,8 +3367,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3393,6 +3405,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3404,10 +3417,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/agat/agat_convert_sp_gff2tsv/.config.vsh.yaml b/target/nextflow/agat/agat_convert_sp_gff2tsv/.config.vsh.yaml index 6b9f6b47..35a824ed 100644 --- a/target/nextflow/agat/agat_convert_sp_gff2tsv/.config.vsh.yaml +++ b/target/nextflow/agat/agat_convert_sp_gff2tsv/.config.vsh.yaml @@ -187,15 +187,16 @@ build_info: engine: "docker|native" output: "target/nextflow/agat/agat_convert_sp_gff2tsv" executable: "target/nextflow/agat/agat_convert_sp_gff2tsv/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/agat/agat_convert_sp_gff2tsv/main.nf b/target/nextflow/agat/agat_convert_sp_gff2tsv/main.nf index c7b82f15..a3133c5d 100644 --- a/target/nextflow/agat/agat_convert_sp_gff2tsv/main.nf +++ b/target/nextflow/agat/agat_convert_sp_gff2tsv/main.nf @@ -1,8 +1,8 @@ // agat_convert_sp_gff2tsv main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3039,15 +3045,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/agat/agat_convert_sp_gff2tsv", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3192,7 +3199,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3323,7 +3334,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3331,8 +3343,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3369,6 +3381,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3380,10 +3393,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/agat/agat_convert_sp_gxf2gxf/.config.vsh.yaml b/target/nextflow/agat/agat_convert_sp_gxf2gxf/.config.vsh.yaml index e2975212..a0c0e821 100644 --- a/target/nextflow/agat/agat_convert_sp_gxf2gxf/.config.vsh.yaml +++ b/target/nextflow/agat/agat_convert_sp_gxf2gxf/.config.vsh.yaml @@ -194,15 +194,16 @@ build_info: engine: "docker|native" output: "target/nextflow/agat/agat_convert_sp_gxf2gxf" executable: "target/nextflow/agat/agat_convert_sp_gxf2gxf/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/agat/agat_convert_sp_gxf2gxf/main.nf b/target/nextflow/agat/agat_convert_sp_gxf2gxf/main.nf index 184bb460..872e6724 100644 --- a/target/nextflow/agat/agat_convert_sp_gxf2gxf/main.nf +++ b/target/nextflow/agat/agat_convert_sp_gxf2gxf/main.nf @@ -1,8 +1,8 @@ // agat_convert_sp_gxf2gxf main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3039,15 +3045,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/agat/agat_convert_sp_gxf2gxf", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3192,7 +3199,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3323,7 +3334,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3331,8 +3343,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3369,6 +3381,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3380,10 +3393,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/arriba/.config.vsh.yaml b/target/nextflow/arriba/.config.vsh.yaml index 5f569296..d7e8ed9d 100644 --- a/target/nextflow/arriba/.config.vsh.yaml +++ b/target/nextflow/arriba/.config.vsh.yaml @@ -705,15 +705,16 @@ build_info: engine: "docker|native" output: "target/nextflow/arriba" executable: "target/nextflow/arriba/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/arriba/main.nf b/target/nextflow/arriba/main.nf index eb7f1a70..23df82db 100644 --- a/target/nextflow/arriba/main.nf +++ b/target/nextflow/arriba/main.nf @@ -1,8 +1,8 @@ // arriba main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3585,15 +3591,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/arriba", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3817,7 +3824,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3948,7 +3959,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3956,8 +3968,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3994,6 +4006,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -4005,10 +4018,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bcftools/bcftools_annotate/.config.vsh.yaml b/target/nextflow/bcftools/bcftools_annotate/.config.vsh.yaml index 173915a8..7ef6a864 100644 --- a/target/nextflow/bcftools/bcftools_annotate/.config.vsh.yaml +++ b/target/nextflow/bcftools/bcftools_annotate/.config.vsh.yaml @@ -468,15 +468,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bcftools/bcftools_annotate" executable: "target/nextflow/bcftools/bcftools_annotate/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bcftools/bcftools_annotate/main.nf b/target/nextflow/bcftools/bcftools_annotate/main.nf index 2d458520..34b384a7 100644 --- a/target/nextflow/bcftools/bcftools_annotate/main.nf +++ b/target/nextflow/bcftools/bcftools_annotate/main.nf @@ -1,8 +1,8 @@ // bcftools_annotate main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3328,15 +3334,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bcftools/bcftools_annotate", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3550,7 +3557,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3681,7 +3692,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3689,8 +3701,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3727,6 +3739,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3738,10 +3751,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bcftools/bcftools_concat/.config.vsh.yaml b/target/nextflow/bcftools/bcftools_concat/.config.vsh.yaml index 27a089dd..91d7c2c1 100644 --- a/target/nextflow/bcftools/bcftools_concat/.config.vsh.yaml +++ b/target/nextflow/bcftools/bcftools_concat/.config.vsh.yaml @@ -334,15 +334,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bcftools/bcftools_concat" executable: "target/nextflow/bcftools/bcftools_concat/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bcftools/bcftools_concat/main.nf b/target/nextflow/bcftools/bcftools_concat/main.nf index 73d3d981..81d18bbc 100644 --- a/target/nextflow/bcftools/bcftools_concat/main.nf +++ b/target/nextflow/bcftools/bcftools_concat/main.nf @@ -1,8 +1,8 @@ // bcftools_concat main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3200,15 +3206,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bcftools/bcftools_concat", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3412,7 +3419,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3543,7 +3554,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3551,8 +3563,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3589,6 +3601,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3600,10 +3613,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bcftools/bcftools_norm/.config.vsh.yaml b/target/nextflow/bcftools/bcftools_norm/.config.vsh.yaml index c312a07b..313a0251 100644 --- a/target/nextflow/bcftools/bcftools_norm/.config.vsh.yaml +++ b/target/nextflow/bcftools/bcftools_norm/.config.vsh.yaml @@ -415,15 +415,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bcftools/bcftools_norm" executable: "target/nextflow/bcftools/bcftools_norm/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bcftools/bcftools_norm/main.nf b/target/nextflow/bcftools/bcftools_norm/main.nf index c22b1d50..c95255fe 100644 --- a/target/nextflow/bcftools/bcftools_norm/main.nf +++ b/target/nextflow/bcftools/bcftools_norm/main.nf @@ -1,8 +1,8 @@ // bcftools_norm main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3293,15 +3299,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bcftools/bcftools_norm", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3505,7 +3512,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3636,7 +3647,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3644,8 +3656,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3682,6 +3694,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3693,10 +3706,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bcftools/bcftools_sort/.config.vsh.yaml b/target/nextflow/bcftools/bcftools_sort/.config.vsh.yaml index 601c5d92..1b7c2540 100644 --- a/target/nextflow/bcftools/bcftools_sort/.config.vsh.yaml +++ b/target/nextflow/bcftools/bcftools_sort/.config.vsh.yaml @@ -184,15 +184,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bcftools/bcftools_sort" executable: "target/nextflow/bcftools/bcftools_sort/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bcftools/bcftools_sort/main.nf b/target/nextflow/bcftools/bcftools_sort/main.nf index 517eb09b..f1366530 100644 --- a/target/nextflow/bcftools/bcftools_sort/main.nf +++ b/target/nextflow/bcftools/bcftools_sort/main.nf @@ -1,8 +1,8 @@ // bcftools_sort main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3041,15 +3047,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bcftools/bcftools_sort", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3200,7 +3207,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3331,7 +3342,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3339,8 +3351,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3377,6 +3389,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3388,10 +3401,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bcftools/bcftools_stats/.config.vsh.yaml b/target/nextflow/bcftools/bcftools_stats/.config.vsh.yaml index 6b75f572..0185fbee 100644 --- a/target/nextflow/bcftools/bcftools_stats/.config.vsh.yaml +++ b/target/nextflow/bcftools/bcftools_stats/.config.vsh.yaml @@ -457,15 +457,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bcftools/bcftools_stats" executable: "target/nextflow/bcftools/bcftools_stats/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bcftools/bcftools_stats/main.nf b/target/nextflow/bcftools/bcftools_stats/main.nf index 419389c0..b6864b14 100644 --- a/target/nextflow/bcftools/bcftools_stats/main.nf +++ b/target/nextflow/bcftools/bcftools_stats/main.nf @@ -1,8 +1,8 @@ // bcftools_stats main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3330,15 +3336,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bcftools/bcftools_stats", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3550,7 +3557,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3681,7 +3692,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3689,8 +3701,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3727,6 +3739,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3738,10 +3751,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bcl_convert/.config.vsh.yaml b/target/nextflow/bcl_convert/.config.vsh.yaml index bf2202f2..124c2b6b 100644 --- a/target/nextflow/bcl_convert/.config.vsh.yaml +++ b/target/nextflow/bcl_convert/.config.vsh.yaml @@ -417,15 +417,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bcl_convert" executable: "target/nextflow/bcl_convert/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bcl_convert/main.nf b/target/nextflow/bcl_convert/main.nf index 1a805022..0a19efa1 100644 --- a/target/nextflow/bcl_convert/main.nf +++ b/target/nextflow/bcl_convert/main.nf @@ -1,8 +1,8 @@ // bcl_convert main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1732,7 +1732,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1803,7 +1805,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1845,7 +1849,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3322,15 +3328,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bcl_convert", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3528,7 +3535,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3659,7 +3670,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3667,8 +3679,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3705,6 +3717,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3716,10 +3729,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/.config.vsh.yaml b/target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/.config.vsh.yaml index 93c04282..3c728c1c 100644 --- a/target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/.config.vsh.yaml +++ b/target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/.config.vsh.yaml @@ -269,15 +269,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bd_rhapsody/bd_rhapsody_make_reference" executable: "target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/main.nf b/target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/main.nf index e396aaae..5875582c 100644 --- a/target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/main.nf +++ b/target/nextflow/bd_rhapsody/bd_rhapsody_make_reference/main.nf @@ -1,8 +1,8 @@ // bd_rhapsody_make_reference main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1732,7 +1732,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1803,7 +1805,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1845,7 +1849,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3135,15 +3141,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bd_rhapsody/bd_rhapsody_make_reference", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3435,7 +3442,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3566,7 +3577,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3574,8 +3586,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3612,6 +3624,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3623,10 +3636,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_bamtofastq/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_bamtofastq/.config.vsh.yaml index f001ad9e..0c587218 100644 --- a/target/nextflow/bedtools/bedtools_bamtofastq/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_bamtofastq/.config.vsh.yaml @@ -186,15 +186,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_bamtofastq" executable: "target/nextflow/bedtools/bedtools_bamtofastq/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_bamtofastq/main.nf b/target/nextflow/bedtools/bedtools_bamtofastq/main.nf index 05b99bc3..6bf737b6 100644 --- a/target/nextflow/bedtools/bedtools_bamtofastq/main.nf +++ b/target/nextflow/bedtools/bedtools_bamtofastq/main.nf @@ -1,8 +1,8 @@ // bedtools_bamtofastq main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3043,15 +3049,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_bamtofastq", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3206,7 +3213,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3337,7 +3348,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3345,8 +3357,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3383,6 +3395,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3394,10 +3407,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_bed12tobed6/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_bed12tobed6/.config.vsh.yaml index 5fd47ccd..5d89e03b 100644 --- a/target/nextflow/bedtools/bedtools_bed12tobed6/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_bed12tobed6/.config.vsh.yaml @@ -175,15 +175,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_bed12tobed6" executable: "target/nextflow/bedtools/bedtools_bed12tobed6/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_bed12tobed6/main.nf b/target/nextflow/bedtools/bedtools_bed12tobed6/main.nf index fc04e863..6a8a64a8 100644 --- a/target/nextflow/bedtools/bedtools_bed12tobed6/main.nf +++ b/target/nextflow/bedtools/bedtools_bed12tobed6/main.nf @@ -1,8 +1,8 @@ // bedtools_bed12tobed6 main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3028,15 +3034,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_bed12tobed6", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3187,7 +3194,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3318,7 +3329,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3326,8 +3338,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3364,6 +3376,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3375,10 +3388,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_bedtobam/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_bedtobam/.config.vsh.yaml index 9942b99f..7335dbae 100644 --- a/target/nextflow/bedtools/bedtools_bedtobam/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_bedtobam/.config.vsh.yaml @@ -213,15 +213,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_bedtobam" executable: "target/nextflow/bedtools/bedtools_bedtobam/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_bedtobam/main.nf b/target/nextflow/bedtools/bedtools_bedtobam/main.nf index 8632dea2..d8196232 100644 --- a/target/nextflow/bedtools/bedtools_bedtobam/main.nf +++ b/target/nextflow/bedtools/bedtools_bedtobam/main.nf @@ -1,8 +1,8 @@ // bedtools_bedtobam main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3076,15 +3082,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_bedtobam", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3242,7 +3249,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3373,7 +3384,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3381,8 +3393,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3419,6 +3431,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3430,10 +3443,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_genomecov/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_genomecov/.config.vsh.yaml index 8af11e92..05555c26 100644 --- a/target/nextflow/bedtools/bedtools_genomecov/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_genomecov/.config.vsh.yaml @@ -336,15 +336,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_genomecov" executable: "target/nextflow/bedtools/bedtools_genomecov/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_genomecov/main.nf b/target/nextflow/bedtools/bedtools_genomecov/main.nf index 2ddfc994..6e9efab5 100644 --- a/target/nextflow/bedtools/bedtools_genomecov/main.nf +++ b/target/nextflow/bedtools/bedtools_genomecov/main.nf @@ -1,8 +1,8 @@ // bedtools_genomecov main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3200,15 +3206,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_genomecov", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3416,7 +3423,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3547,7 +3558,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3555,8 +3567,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3593,6 +3605,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3604,10 +3617,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_getfasta/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_getfasta/.config.vsh.yaml index 8e81aeac..709dadd0 100644 --- a/target/nextflow/bedtools/bedtools_getfasta/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_getfasta/.config.vsh.yaml @@ -231,15 +231,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_getfasta" executable: "target/nextflow/bedtools/bedtools_getfasta/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_getfasta/main.nf b/target/nextflow/bedtools/bedtools_getfasta/main.nf index 46fb5144..8d73fca9 100644 --- a/target/nextflow/bedtools/bedtools_getfasta/main.nf +++ b/target/nextflow/bedtools/bedtools_getfasta/main.nf @@ -1,8 +1,8 @@ // bedtools_getfasta main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3079,15 +3085,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_getfasta", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3254,7 +3261,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3385,7 +3396,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3393,8 +3405,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3431,6 +3443,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3442,10 +3455,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_groupby/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_groupby/.config.vsh.yaml index caf9e6e3..1664e950 100644 --- a/target/nextflow/bedtools/bedtools_groupby/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_groupby/.config.vsh.yaml @@ -272,15 +272,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_groupby" executable: "target/nextflow/bedtools/bedtools_groupby/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_groupby/main.nf b/target/nextflow/bedtools/bedtools_groupby/main.nf index 95a4c066..e0f16402 100644 --- a/target/nextflow/bedtools/bedtools_groupby/main.nf +++ b/target/nextflow/bedtools/bedtools_groupby/main.nf @@ -1,8 +1,8 @@ // bedtools_groupby main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3123,15 +3129,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_groupby", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3312,7 +3319,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3443,7 +3454,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3451,8 +3463,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3489,6 +3501,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3500,10 +3513,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_intersect/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_intersect/.config.vsh.yaml index db57a4e8..6f14bd8d 100644 --- a/target/nextflow/bedtools/bedtools_intersect/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_intersect/.config.vsh.yaml @@ -409,15 +409,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_intersect" executable: "target/nextflow/bedtools/bedtools_intersect/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_intersect/main.nf b/target/nextflow/bedtools/bedtools_intersect/main.nf index 8057f6ab..e3b6293d 100644 --- a/target/nextflow/bedtools/bedtools_intersect/main.nf +++ b/target/nextflow/bedtools/bedtools_intersect/main.nf @@ -1,8 +1,8 @@ // bedtools_intersect main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3275,15 +3281,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_intersect", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3514,7 +3521,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3645,7 +3656,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3653,8 +3665,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3691,6 +3703,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3702,10 +3715,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_links/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_links/.config.vsh.yaml index 6ae01a9d..fccf16f8 100644 --- a/target/nextflow/bedtools/bedtools_links/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_links/.config.vsh.yaml @@ -209,15 +209,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_links" executable: "target/nextflow/bedtools/bedtools_links/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_links/main.nf b/target/nextflow/bedtools/bedtools_links/main.nf index 3bc107c1..99af1c40 100644 --- a/target/nextflow/bedtools/bedtools_links/main.nf +++ b/target/nextflow/bedtools/bedtools_links/main.nf @@ -1,8 +1,8 @@ // bedtools_links main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3066,15 +3072,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_links", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3226,7 +3233,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3357,7 +3368,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3365,8 +3377,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3403,6 +3415,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3414,10 +3427,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_merge/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_merge/.config.vsh.yaml index 9f85d3d8..281bf61d 100644 --- a/target/nextflow/bedtools/bedtools_merge/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_merge/.config.vsh.yaml @@ -278,15 +278,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_merge" executable: "target/nextflow/bedtools/bedtools_merge/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_merge/main.nf b/target/nextflow/bedtools/bedtools_merge/main.nf index b20c10e9..fe4f256a 100644 --- a/target/nextflow/bedtools/bedtools_merge/main.nf +++ b/target/nextflow/bedtools/bedtools_merge/main.nf @@ -1,8 +1,8 @@ // bedtools_merge main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3127,15 +3133,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_merge", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3315,7 +3322,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3446,7 +3457,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3454,8 +3466,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3492,6 +3504,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3503,10 +3516,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/bedtools/bedtools_sort/.config.vsh.yaml b/target/nextflow/bedtools/bedtools_sort/.config.vsh.yaml index 8d32fc31..4670f419 100644 --- a/target/nextflow/bedtools/bedtools_sort/.config.vsh.yaml +++ b/target/nextflow/bedtools/bedtools_sort/.config.vsh.yaml @@ -221,15 +221,16 @@ build_info: engine: "docker|native" output: "target/nextflow/bedtools/bedtools_sort" executable: "target/nextflow/bedtools/bedtools_sort/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/bedtools/bedtools_sort/main.nf b/target/nextflow/bedtools/bedtools_sort/main.nf index f409c177..e1759cf1 100644 --- a/target/nextflow/bedtools/bedtools_sort/main.nf +++ b/target/nextflow/bedtools/bedtools_sort/main.nf @@ -1,8 +1,8 @@ // bedtools_sort main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3085,15 +3091,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/bedtools/bedtools_sort", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3271,7 +3278,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3402,7 +3413,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3410,8 +3422,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3448,6 +3460,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3459,10 +3472,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/busco/busco_download_datasets/.config.vsh.yaml b/target/nextflow/busco/busco_download_datasets/.config.vsh.yaml index 6b4fc962..0561623e 100644 --- a/target/nextflow/busco/busco_download_datasets/.config.vsh.yaml +++ b/target/nextflow/busco/busco_download_datasets/.config.vsh.yaml @@ -157,15 +157,16 @@ build_info: engine: "docker|native" output: "target/nextflow/busco/busco_download_datasets" executable: "target/nextflow/busco/busco_download_datasets/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/busco/busco_download_datasets/main.nf b/target/nextflow/busco/busco_download_datasets/main.nf index a6a4cd3e..468197c2 100644 --- a/target/nextflow/busco/busco_download_datasets/main.nf +++ b/target/nextflow/busco/busco_download_datasets/main.nf @@ -1,8 +1,8 @@ // busco_download_datasets main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3004,15 +3010,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/busco/busco_download_datasets", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3161,7 +3168,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3292,7 +3303,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3300,8 +3312,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3338,6 +3350,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3349,10 +3362,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/busco/busco_list_datasets/.config.vsh.yaml b/target/nextflow/busco/busco_list_datasets/.config.vsh.yaml index a5322443..d9617a9d 100644 --- a/target/nextflow/busco/busco_list_datasets/.config.vsh.yaml +++ b/target/nextflow/busco/busco_list_datasets/.config.vsh.yaml @@ -144,15 +144,16 @@ build_info: engine: "docker|native" output: "target/nextflow/busco/busco_list_datasets" executable: "target/nextflow/busco/busco_list_datasets/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/busco/busco_list_datasets/main.nf b/target/nextflow/busco/busco_list_datasets/main.nf index e765ba9a..8ff07d24 100644 --- a/target/nextflow/busco/busco_list_datasets/main.nf +++ b/target/nextflow/busco/busco_list_datasets/main.nf @@ -1,8 +1,8 @@ // busco_list_datasets main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -2990,15 +2996,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/busco/busco_list_datasets", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3138,7 +3145,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3269,7 +3280,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3277,8 +3289,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3315,6 +3327,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3326,10 +3339,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/busco/busco_run/.config.vsh.yaml b/target/nextflow/busco/busco_run/.config.vsh.yaml index 02a053aa..7ec38e51 100644 --- a/target/nextflow/busco/busco_run/.config.vsh.yaml +++ b/target/nextflow/busco/busco_run/.config.vsh.yaml @@ -422,15 +422,16 @@ build_info: engine: "docker|native" output: "target/nextflow/busco/busco_run" executable: "target/nextflow/busco/busco_run/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/busco/busco_run/main.nf b/target/nextflow/busco/busco_run/main.nf index 526601e9..6e8e3870 100644 --- a/target/nextflow/busco/busco_run/main.nf +++ b/target/nextflow/busco/busco_run/main.nf @@ -1,8 +1,8 @@ // busco_run main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3302,15 +3308,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/busco/busco_run", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3548,7 +3555,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3679,7 +3690,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3687,8 +3699,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3725,6 +3737,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3736,10 +3749,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/cutadapt/.config.vsh.yaml b/target/nextflow/cutadapt/.config.vsh.yaml index 00778cc8..e9d887b4 100644 --- a/target/nextflow/cutadapt/.config.vsh.yaml +++ b/target/nextflow/cutadapt/.config.vsh.yaml @@ -739,15 +739,16 @@ build_info: engine: "docker|native" output: "target/nextflow/cutadapt" executable: "target/nextflow/cutadapt/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/cutadapt/main.nf b/target/nextflow/cutadapt/main.nf index 93ec0d17..2d23d239 100644 --- a/target/nextflow/cutadapt/main.nf +++ b/target/nextflow/cutadapt/main.nf @@ -1,8 +1,8 @@ // cutadapt main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3612,15 +3618,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/cutadapt", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -4059,7 +4066,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -4190,7 +4201,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -4198,8 +4210,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -4236,6 +4248,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -4247,10 +4260,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/falco/.config.vsh.yaml b/target/nextflow/falco/.config.vsh.yaml index 85c3caa4..a266d519 100644 --- a/target/nextflow/falco/.config.vsh.yaml +++ b/target/nextflow/falco/.config.vsh.yaml @@ -316,15 +316,16 @@ build_info: engine: "docker|native" output: "target/nextflow/falco" executable: "target/nextflow/falco/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/falco/main.nf b/target/nextflow/falco/main.nf index 173ee03d..955dcec8 100644 --- a/target/nextflow/falco/main.nf +++ b/target/nextflow/falco/main.nf @@ -1,8 +1,8 @@ // falco main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3163,15 +3169,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/falco", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3343,7 +3350,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3474,7 +3485,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3482,8 +3494,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3520,6 +3532,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3531,10 +3544,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/fastp/.config.vsh.yaml b/target/nextflow/fastp/.config.vsh.yaml index 96f43099..42807a08 100644 --- a/target/nextflow/fastp/.config.vsh.yaml +++ b/target/nextflow/fastp/.config.vsh.yaml @@ -1082,15 +1082,16 @@ build_info: engine: "docker|native" output: "target/nextflow/fastp" executable: "target/nextflow/fastp/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/fastp/main.nf b/target/nextflow/fastp/main.nf index 15ddefef..5ba2530b 100644 --- a/target/nextflow/fastp/main.nf +++ b/target/nextflow/fastp/main.nf @@ -1,8 +1,8 @@ // fastp main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -4016,15 +4022,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/fastp", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -4345,7 +4352,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -4476,7 +4487,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -4484,8 +4496,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -4522,6 +4534,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -4533,10 +4546,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/fastqc/.config.vsh.yaml b/target/nextflow/fastqc/.config.vsh.yaml index cf27fe59..7c46b27d 100644 --- a/target/nextflow/fastqc/.config.vsh.yaml +++ b/target/nextflow/fastqc/.config.vsh.yaml @@ -339,15 +339,16 @@ build_info: engine: "docker|native" output: "target/nextflow/fastqc" executable: "target/nextflow/fastqc/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/fastqc/main.nf b/target/nextflow/fastqc/main.nf index 2872f578..fab9d35f 100644 --- a/target/nextflow/fastqc/main.nf +++ b/target/nextflow/fastqc/main.nf @@ -1,8 +1,8 @@ // fastqc main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3175,15 +3181,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/fastqc", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3417,7 +3424,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3548,7 +3559,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3556,8 +3568,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3594,6 +3606,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3605,10 +3618,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/featurecounts/.config.vsh.yaml b/target/nextflow/featurecounts/.config.vsh.yaml index 8f8e1c05..a0d8dd42 100644 --- a/target/nextflow/featurecounts/.config.vsh.yaml +++ b/target/nextflow/featurecounts/.config.vsh.yaml @@ -644,15 +644,16 @@ build_info: engine: "docker|native" output: "target/nextflow/featurecounts" executable: "target/nextflow/featurecounts/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/featurecounts/main.nf b/target/nextflow/featurecounts/main.nf index 5aacba4c..539bd772 100644 --- a/target/nextflow/featurecounts/main.nf +++ b/target/nextflow/featurecounts/main.nf @@ -1,8 +1,8 @@ // featurecounts main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3542,15 +3548,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/featurecounts", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3828,7 +3835,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3959,7 +3970,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3967,8 +3979,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -4005,6 +4017,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -4016,10 +4029,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/fq_subsample/.config.vsh.yaml b/target/nextflow/fq_subsample/.config.vsh.yaml index f838d946..222a846f 100644 --- a/target/nextflow/fq_subsample/.config.vsh.yaml +++ b/target/nextflow/fq_subsample/.config.vsh.yaml @@ -189,15 +189,16 @@ build_info: engine: "docker|native" output: "target/nextflow/fq_subsample" executable: "target/nextflow/fq_subsample/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/fq_subsample/main.nf b/target/nextflow/fq_subsample/main.nf index 7396d4a6..53dded1e 100644 --- a/target/nextflow/fq_subsample/main.nf +++ b/target/nextflow/fq_subsample/main.nf @@ -1,8 +1,8 @@ // fq_subsample main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1728,7 +1728,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1799,7 +1801,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1841,7 +1845,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3025,15 +3031,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/fq_subsample", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3198,7 +3205,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3329,7 +3340,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3337,8 +3349,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3375,6 +3387,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3386,10 +3399,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/gffread/.config.vsh.yaml b/target/nextflow/gffread/.config.vsh.yaml index 2a6c6e9b..000183fe 100644 --- a/target/nextflow/gffread/.config.vsh.yaml +++ b/target/nextflow/gffread/.config.vsh.yaml @@ -684,15 +684,16 @@ build_info: engine: "docker|native" output: "target/nextflow/gffread" executable: "target/nextflow/gffread/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/gffread/main.nf b/target/nextflow/gffread/main.nf index 1cb0005b..43b956fc 100644 --- a/target/nextflow/gffread/main.nf +++ b/target/nextflow/gffread/main.nf @@ -1,8 +1,8 @@ // gffread main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3599,15 +3605,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/gffread", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3931,7 +3938,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -4062,7 +4073,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -4070,8 +4082,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -4108,6 +4120,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -4119,10 +4132,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/kallisto/kallisto_index/.config.vsh.yaml b/target/nextflow/kallisto/kallisto_index/.config.vsh.yaml index 9c81e98a..8e6724e1 100644 --- a/target/nextflow/kallisto/kallisto_index/.config.vsh.yaml +++ b/target/nextflow/kallisto/kallisto_index/.config.vsh.yaml @@ -217,15 +217,16 @@ build_info: engine: "docker|native" output: "target/nextflow/kallisto/kallisto_index" executable: "target/nextflow/kallisto/kallisto_index/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/kallisto/kallisto_index/main.nf b/target/nextflow/kallisto/kallisto_index/main.nf index 8dc3f308..b90ef6ba 100644 --- a/target/nextflow/kallisto/kallisto_index/main.nf +++ b/target/nextflow/kallisto/kallisto_index/main.nf @@ -1,8 +1,8 @@ // kallisto_index main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1728,7 +1728,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1799,7 +1801,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1841,7 +1845,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3064,15 +3070,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/kallisto/kallisto_index", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3248,7 +3255,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3379,7 +3390,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3387,8 +3399,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3425,6 +3437,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3436,10 +3449,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/lofreq/lofreq_call/.config.vsh.yaml b/target/nextflow/lofreq/lofreq_call/.config.vsh.yaml index d1179b0d..a9b82ef2 100644 --- a/target/nextflow/lofreq/lofreq_call/.config.vsh.yaml +++ b/target/nextflow/lofreq/lofreq_call/.config.vsh.yaml @@ -506,15 +506,16 @@ build_info: engine: "docker|native" output: "target/nextflow/lofreq/lofreq_call" executable: "target/nextflow/lofreq/lofreq_call/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/lofreq/lofreq_call/main.nf b/target/nextflow/lofreq/lofreq_call/main.nf index 52c470ef..f06333a9 100644 --- a/target/nextflow/lofreq/lofreq_call/main.nf +++ b/target/nextflow/lofreq/lofreq_call/main.nf @@ -1,8 +1,8 @@ // lofreq_call main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3407,15 +3413,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/lofreq/lofreq_call", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3647,7 +3654,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3778,7 +3789,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3786,8 +3798,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3824,6 +3836,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3835,10 +3848,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/lofreq/lofreq_indelqual/.config.vsh.yaml b/target/nextflow/lofreq/lofreq_indelqual/.config.vsh.yaml index 9da005a9..7ba2350d 100644 --- a/target/nextflow/lofreq/lofreq_indelqual/.config.vsh.yaml +++ b/target/nextflow/lofreq/lofreq_indelqual/.config.vsh.yaml @@ -214,15 +214,16 @@ build_info: engine: "docker|native" output: "target/nextflow/lofreq/lofreq_indelqual" executable: "target/nextflow/lofreq/lofreq_indelqual/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/lofreq/lofreq_indelqual/main.nf b/target/nextflow/lofreq/lofreq_indelqual/main.nf index 2385c322..d64ab9a7 100644 --- a/target/nextflow/lofreq/lofreq_indelqual/main.nf +++ b/target/nextflow/lofreq/lofreq_indelqual/main.nf @@ -1,8 +1,8 @@ // lofreq_indelqual main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3070,15 +3076,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/lofreq/lofreq_indelqual", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3234,7 +3241,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3365,7 +3376,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3373,8 +3385,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3411,6 +3423,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3422,10 +3435,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/multiqc/.config.vsh.yaml b/target/nextflow/multiqc/.config.vsh.yaml index 338ed280..a512243f 100644 --- a/target/nextflow/multiqc/.config.vsh.yaml +++ b/target/nextflow/multiqc/.config.vsh.yaml @@ -455,15 +455,16 @@ build_info: engine: "docker|native" output: "target/nextflow/multiqc" executable: "target/nextflow/multiqc/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/multiqc/main.nf b/target/nextflow/multiqc/main.nf index 90245428..de8ac686 100644 --- a/target/nextflow/multiqc/main.nf +++ b/target/nextflow/multiqc/main.nf @@ -1,8 +1,8 @@ // multiqc main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3359,15 +3365,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/multiqc", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3674,7 +3681,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3805,7 +3816,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3813,8 +3825,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3851,6 +3863,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3862,10 +3875,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/pear/.config.vsh.yaml b/target/nextflow/pear/.config.vsh.yaml index 2558d0f2..9f5d68a0 100644 --- a/target/nextflow/pear/.config.vsh.yaml +++ b/target/nextflow/pear/.config.vsh.yaml @@ -397,15 +397,16 @@ build_info: engine: "docker|native" output: "target/nextflow/pear" executable: "target/nextflow/pear/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/pear/main.nf b/target/nextflow/pear/main.nf index a92887ff..f89043e8 100644 --- a/target/nextflow/pear/main.nf +++ b/target/nextflow/pear/main.nf @@ -1,8 +1,8 @@ // pear main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3252,15 +3258,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/pear", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3477,7 +3484,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3608,7 +3619,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3616,8 +3628,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3654,6 +3666,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3665,10 +3678,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/qualimap/qualimap_rnaseq/.config.vsh.yaml b/target/nextflow/qualimap/qualimap_rnaseq/.config.vsh.yaml index cad2506b..aa3ba09a 100644 --- a/target/nextflow/qualimap/qualimap_rnaseq/.config.vsh.yaml +++ b/target/nextflow/qualimap/qualimap_rnaseq/.config.vsh.yaml @@ -263,15 +263,16 @@ build_info: engine: "docker|native" output: "target/nextflow/qualimap/qualimap_rnaseq" executable: "target/nextflow/qualimap/qualimap_rnaseq/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/qualimap/qualimap_rnaseq/main.nf b/target/nextflow/qualimap/qualimap_rnaseq/main.nf index 02f653dc..bab5336a 100644 --- a/target/nextflow/qualimap/qualimap_rnaseq/main.nf +++ b/target/nextflow/qualimap/qualimap_rnaseq/main.nf @@ -1,8 +1,8 @@ // qualimap_rnaseq main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3122,15 +3128,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/qualimap/qualimap_rnaseq", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3327,7 +3334,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3458,7 +3469,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3466,8 +3478,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3504,6 +3516,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3515,10 +3528,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/rsem/rsem_prepare_reference/.config.vsh.yaml b/target/nextflow/rsem/rsem_prepare_reference/.config.vsh.yaml index 5275f502..5477af57 100644 --- a/target/nextflow/rsem/rsem_prepare_reference/.config.vsh.yaml +++ b/target/nextflow/rsem/rsem_prepare_reference/.config.vsh.yaml @@ -415,15 +415,16 @@ build_info: engine: "docker|native" output: "target/nextflow/rsem/rsem_prepare_reference" executable: "target/nextflow/rsem/rsem_prepare_reference/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/rsem/rsem_prepare_reference/main.nf b/target/nextflow/rsem/rsem_prepare_reference/main.nf index 217c9afe..76d2fee9 100644 --- a/target/nextflow/rsem/rsem_prepare_reference/main.nf +++ b/target/nextflow/rsem/rsem_prepare_reference/main.nf @@ -1,8 +1,8 @@ // rsem_prepare_reference main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3238,15 +3244,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/rsem/rsem_prepare_reference", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3444,7 +3451,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3575,7 +3586,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3583,8 +3595,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3621,6 +3633,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3632,10 +3645,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/salmon/salmon_index/.config.vsh.yaml b/target/nextflow/salmon/salmon_index/.config.vsh.yaml index cca14ec4..5041e6ba 100644 --- a/target/nextflow/salmon/salmon_index/.config.vsh.yaml +++ b/target/nextflow/salmon/salmon_index/.config.vsh.yaml @@ -276,15 +276,16 @@ build_info: engine: "docker|native" output: "target/nextflow/salmon/salmon_index" executable: "target/nextflow/salmon/salmon_index/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/salmon/salmon_index/main.nf b/target/nextflow/salmon/salmon_index/main.nf index 7d6516b3..20834790 100644 --- a/target/nextflow/salmon/salmon_index/main.nf +++ b/target/nextflow/salmon/salmon_index/main.nf @@ -1,8 +1,8 @@ // salmon_index main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3122,15 +3128,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/salmon/salmon_index", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3332,7 +3339,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3463,7 +3474,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3471,8 +3483,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3509,6 +3521,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3520,10 +3533,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/salmon/salmon_quant/.config.vsh.yaml b/target/nextflow/salmon/salmon_quant/.config.vsh.yaml index 6bae01dd..d2105341 100644 --- a/target/nextflow/salmon/salmon_quant/.config.vsh.yaml +++ b/target/nextflow/salmon/salmon_quant/.config.vsh.yaml @@ -1172,15 +1172,16 @@ build_info: engine: "docker|native" output: "target/nextflow/salmon/salmon_quant" executable: "target/nextflow/salmon/salmon_quant/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/salmon/salmon_quant/main.nf b/target/nextflow/salmon/salmon_quant/main.nf index 1ac2876f..e5365fd1 100644 --- a/target/nextflow/salmon/salmon_quant/main.nf +++ b/target/nextflow/salmon/salmon_quant/main.nf @@ -1,8 +1,8 @@ // salmon_quant main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3957,15 +3963,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/salmon/salmon_quant", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -4347,7 +4354,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -4478,7 +4489,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -4486,8 +4498,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -4524,6 +4536,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -4535,10 +4548,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_collate/.config.vsh.yaml b/target/nextflow/samtools/samtools_collate/.config.vsh.yaml index 29007fde..99396ff7 100644 --- a/target/nextflow/samtools/samtools_collate/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_collate/.config.vsh.yaml @@ -263,15 +263,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_collate" executable: "target/nextflow/samtools/samtools_collate/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_collate/main.nf b/target/nextflow/samtools/samtools_collate/main.nf index 6734056c..0dfc115c 100644 --- a/target/nextflow/samtools/samtools_collate/main.nf +++ b/target/nextflow/samtools/samtools_collate/main.nf @@ -1,8 +1,8 @@ // samtools_collate main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3133,15 +3139,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_collate", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3314,7 +3321,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3445,7 +3456,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3453,8 +3465,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3491,6 +3503,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3502,10 +3515,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_faidx/.config.vsh.yaml b/target/nextflow/samtools/samtools_faidx/.config.vsh.yaml index 13f48bf1..62221794 100644 --- a/target/nextflow/samtools/samtools_faidx/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_faidx/.config.vsh.yaml @@ -242,15 +242,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_faidx" executable: "target/nextflow/samtools/samtools_faidx/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_faidx/main.nf b/target/nextflow/samtools/samtools_faidx/main.nf index a93a8335..dd98b063 100644 --- a/target/nextflow/samtools/samtools_faidx/main.nf +++ b/target/nextflow/samtools/samtools_faidx/main.nf @@ -1,8 +1,8 @@ // samtools_faidx main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3105,15 +3111,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_faidx", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3280,7 +3287,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3411,7 +3422,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3419,8 +3431,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3457,6 +3469,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3468,10 +3481,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_fasta/.config.vsh.yaml b/target/nextflow/samtools/samtools_fasta/.config.vsh.yaml index 4bb00ce5..8911bb2a 100644 --- a/target/nextflow/samtools/samtools_fasta/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_fasta/.config.vsh.yaml @@ -432,15 +432,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_fasta" executable: "target/nextflow/samtools/samtools_fasta/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_fasta/main.nf b/target/nextflow/samtools/samtools_fasta/main.nf index 74adfe5b..18382cfe 100644 --- a/target/nextflow/samtools/samtools_fasta/main.nf +++ b/target/nextflow/samtools/samtools_fasta/main.nf @@ -1,8 +1,8 @@ // samtools_fasta main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3297,15 +3303,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_fasta", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3516,7 +3523,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3647,7 +3658,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3655,8 +3667,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3693,6 +3705,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3704,10 +3717,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_fastq/.config.vsh.yaml b/target/nextflow/samtools/samtools_fastq/.config.vsh.yaml index b74ca804..3d639c8b 100644 --- a/target/nextflow/samtools/samtools_fastq/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_fastq/.config.vsh.yaml @@ -432,15 +432,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_fastq" executable: "target/nextflow/samtools/samtools_fastq/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_fastq/main.nf b/target/nextflow/samtools/samtools_fastq/main.nf index c2da7a30..9d2157fc 100644 --- a/target/nextflow/samtools/samtools_fastq/main.nf +++ b/target/nextflow/samtools/samtools_fastq/main.nf @@ -1,8 +1,8 @@ // samtools_fastq main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3297,15 +3303,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_fastq", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3516,7 +3523,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3647,7 +3658,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3655,8 +3667,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3693,6 +3705,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3704,10 +3717,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_flagstat/.config.vsh.yaml b/target/nextflow/samtools/samtools_flagstat/.config.vsh.yaml index 32ae6a54..47501026 100644 --- a/target/nextflow/samtools/samtools_flagstat/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_flagstat/.config.vsh.yaml @@ -172,15 +172,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_flagstat" executable: "target/nextflow/samtools/samtools_flagstat/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_flagstat/main.nf b/target/nextflow/samtools/samtools_flagstat/main.nf index 2330cdb6..f0a15082 100644 --- a/target/nextflow/samtools/samtools_flagstat/main.nf +++ b/target/nextflow/samtools/samtools_flagstat/main.nf @@ -1,8 +1,8 @@ // samtools_flagstat main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3021,15 +3027,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_flagstat", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3176,7 +3183,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3307,7 +3318,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3315,8 +3327,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3353,6 +3365,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3364,10 +3377,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_idxstats/.config.vsh.yaml b/target/nextflow/samtools/samtools_idxstats/.config.vsh.yaml index 9a939b76..cb97bcc4 100644 --- a/target/nextflow/samtools/samtools_idxstats/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_idxstats/.config.vsh.yaml @@ -182,15 +182,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_idxstats" executable: "target/nextflow/samtools/samtools_idxstats/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_idxstats/main.nf b/target/nextflow/samtools/samtools_idxstats/main.nf index 71e9dd71..8c5a4199 100644 --- a/target/nextflow/samtools/samtools_idxstats/main.nf +++ b/target/nextflow/samtools/samtools_idxstats/main.nf @@ -1,8 +1,8 @@ // samtools_idxstats main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3033,15 +3039,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_idxstats", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3186,7 +3193,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3317,7 +3328,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3325,8 +3337,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3363,6 +3375,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3374,10 +3387,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_index/.config.vsh.yaml b/target/nextflow/samtools/samtools_index/.config.vsh.yaml index d95ec405..349ae7e2 100644 --- a/target/nextflow/samtools/samtools_index/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_index/.config.vsh.yaml @@ -188,15 +188,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_index" executable: "target/nextflow/samtools/samtools_index/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_index/main.nf b/target/nextflow/samtools/samtools_index/main.nf index b677c232..03991a80 100644 --- a/target/nextflow/samtools/samtools_index/main.nf +++ b/target/nextflow/samtools/samtools_index/main.nf @@ -1,8 +1,8 @@ // samtools_index main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3046,15 +3052,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_index", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3210,7 +3217,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3341,7 +3352,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3349,8 +3361,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3387,6 +3399,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3398,10 +3411,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_sort/.config.vsh.yaml b/target/nextflow/samtools/samtools_sort/.config.vsh.yaml index a61916d4..1ee2c7c0 100644 --- a/target/nextflow/samtools/samtools_sort/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_sort/.config.vsh.yaml @@ -331,15 +331,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_sort" executable: "target/nextflow/samtools/samtools_sort/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_sort/main.nf b/target/nextflow/samtools/samtools_sort/main.nf index 1d8f4f89..f25d85ac 100644 --- a/target/nextflow/samtools/samtools_sort/main.nf +++ b/target/nextflow/samtools/samtools_sort/main.nf @@ -1,8 +1,8 @@ // samtools_sort main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3218,15 +3224,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_sort", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3430,7 +3437,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3561,7 +3572,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3569,8 +3581,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3607,6 +3619,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3618,10 +3631,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_stats/.config.vsh.yaml b/target/nextflow/samtools/samtools_stats/.config.vsh.yaml index a27712ff..a8936142 100644 --- a/target/nextflow/samtools/samtools_stats/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_stats/.config.vsh.yaml @@ -400,15 +400,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_stats" executable: "target/nextflow/samtools/samtools_stats/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_stats/main.nf b/target/nextflow/samtools/samtools_stats/main.nf index b981d5fd..c19fb9c1 100644 --- a/target/nextflow/samtools/samtools_stats/main.nf +++ b/target/nextflow/samtools/samtools_stats/main.nf @@ -1,8 +1,8 @@ // samtools_stats main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3288,15 +3294,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_stats", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3492,7 +3499,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3623,7 +3634,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3631,8 +3643,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3669,6 +3681,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3680,10 +3693,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/samtools/samtools_view/.config.vsh.yaml b/target/nextflow/samtools/samtools_view/.config.vsh.yaml index afce6464..bf459437 100644 --- a/target/nextflow/samtools/samtools_view/.config.vsh.yaml +++ b/target/nextflow/samtools/samtools_view/.config.vsh.yaml @@ -664,15 +664,16 @@ build_info: engine: "docker|native" output: "target/nextflow/samtools/samtools_view" executable: "target/nextflow/samtools/samtools_view/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/samtools/samtools_view/main.nf b/target/nextflow/samtools/samtools_view/main.nf index cbadb022..b99df522 100644 --- a/target/nextflow/samtools/samtools_view/main.nf +++ b/target/nextflow/samtools/samtools_view/main.nf @@ -1,8 +1,8 @@ // samtools_view main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3469,15 +3475,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/samtools/samtools_view", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3734,7 +3741,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3865,7 +3876,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3873,8 +3885,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3911,6 +3923,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3922,10 +3935,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/seqtk/seqtk_sample/.config.vsh.yaml b/target/nextflow/seqtk/seqtk_sample/.config.vsh.yaml index 6a497a44..c1e0b7ef 100644 --- a/target/nextflow/seqtk/seqtk_sample/.config.vsh.yaml +++ b/target/nextflow/seqtk/seqtk_sample/.config.vsh.yaml @@ -172,15 +172,16 @@ build_info: engine: "docker|native" output: "target/nextflow/seqtk/seqtk_sample" executable: "target/nextflow/seqtk/seqtk_sample/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/seqtk/seqtk_sample/main.nf b/target/nextflow/seqtk/seqtk_sample/main.nf index 769d60ab..253010b0 100644 --- a/target/nextflow/seqtk/seqtk_sample/main.nf +++ b/target/nextflow/seqtk/seqtk_sample/main.nf @@ -1,8 +1,8 @@ // seqtk_sample main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3023,15 +3029,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/seqtk/seqtk_sample", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3180,7 +3187,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3311,7 +3322,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3319,8 +3331,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3357,6 +3369,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3368,10 +3381,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/seqtk/seqtk_subseq/.config.vsh.yaml b/target/nextflow/seqtk/seqtk_subseq/.config.vsh.yaml index 8cdb17bc..b1deabb3 100644 --- a/target/nextflow/seqtk/seqtk_subseq/.config.vsh.yaml +++ b/target/nextflow/seqtk/seqtk_subseq/.config.vsh.yaml @@ -195,15 +195,16 @@ build_info: engine: "docker|native" output: "target/nextflow/seqtk/seqtk_subseq" executable: "target/nextflow/seqtk/seqtk_subseq/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/seqtk/seqtk_subseq/main.nf b/target/nextflow/seqtk/seqtk_subseq/main.nf index cc4dbd34..71d67a2f 100644 --- a/target/nextflow/seqtk/seqtk_subseq/main.nf +++ b/target/nextflow/seqtk/seqtk_subseq/main.nf @@ -1,8 +1,8 @@ // seqtk_subseq main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3053,15 +3059,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/seqtk/seqtk_subseq", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3215,7 +3222,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3346,7 +3357,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3354,8 +3366,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3392,6 +3404,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3403,10 +3416,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/sortmerna/.config.vsh.yaml b/target/nextflow/sortmerna/.config.vsh.yaml index 592789ca..3b2c1480 100644 --- a/target/nextflow/sortmerna/.config.vsh.yaml +++ b/target/nextflow/sortmerna/.config.vsh.yaml @@ -590,15 +590,16 @@ build_info: engine: "docker|native" output: "target/nextflow/sortmerna" executable: "target/nextflow/sortmerna/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/sortmerna/main.nf b/target/nextflow/sortmerna/main.nf index 706c208d..5f558302 100644 --- a/target/nextflow/sortmerna/main.nf +++ b/target/nextflow/sortmerna/main.nf @@ -1,8 +1,8 @@ // sortmerna main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1728,7 +1728,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1799,7 +1801,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1841,7 +1845,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3449,15 +3455,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/sortmerna", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3743,7 +3750,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3874,7 +3885,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3882,8 +3894,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3920,6 +3932,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3931,10 +3944,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/star/star_align_reads/.config.vsh.yaml b/target/nextflow/star/star_align_reads/.config.vsh.yaml index 96320d49..5640b42d 100644 --- a/target/nextflow/star/star_align_reads/.config.vsh.yaml +++ b/target/nextflow/star/star_align_reads/.config.vsh.yaml @@ -2662,15 +2662,16 @@ build_info: engine: "docker|native" output: "target/nextflow/star/star_align_reads" executable: "target/nextflow/star/star_align_reads/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/star/star_align_reads/main.nf b/target/nextflow/star/star_align_reads/main.nf index 1ae0a116..b3d1b365 100644 --- a/target/nextflow/star/star_align_reads/main.nf +++ b/target/nextflow/star/star_align_reads/main.nf @@ -1,8 +1,8 @@ // star_align_reads main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1732,7 +1732,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1803,7 +1805,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1845,7 +1849,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -5936,15 +5942,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/star/star_align_reads", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -6384,7 +6391,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -6515,7 +6526,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -6523,8 +6535,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -6561,6 +6573,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -6572,10 +6585,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/star/star_genome_generate/.config.vsh.yaml b/target/nextflow/star/star_genome_generate/.config.vsh.yaml index 5e7c3540..e70f6c4d 100644 --- a/target/nextflow/star/star_genome_generate/.config.vsh.yaml +++ b/target/nextflow/star/star_genome_generate/.config.vsh.yaml @@ -332,15 +332,16 @@ build_info: engine: "docker|native" output: "target/nextflow/star/star_genome_generate" executable: "target/nextflow/star/star_genome_generate/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/star/star_genome_generate/main.nf b/target/nextflow/star/star_genome_generate/main.nf index ff1dc704..a853b34c 100644 --- a/target/nextflow/star/star_genome_generate/main.nf +++ b/target/nextflow/star/star_genome_generate/main.nf @@ -1,8 +1,8 @@ // star_genome_generate main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3188,15 +3194,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/star/star_genome_generate", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3375,7 +3382,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3506,7 +3517,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3514,8 +3526,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3552,6 +3564,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3563,10 +3576,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/umi_tools/umi_tools_dedup/.config.vsh.yaml b/target/nextflow/umi_tools/umi_tools_dedup/.config.vsh.yaml index 31f2de8a..c0a1a609 100644 --- a/target/nextflow/umi_tools/umi_tools_dedup/.config.vsh.yaml +++ b/target/nextflow/umi_tools/umi_tools_dedup/.config.vsh.yaml @@ -610,15 +610,16 @@ build_info: engine: "docker|native" output: "target/nextflow/umi_tools/umi_tools_dedup" executable: "target/nextflow/umi_tools/umi_tools_dedup/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/umi_tools/umi_tools_dedup/main.nf b/target/nextflow/umi_tools/umi_tools_dedup/main.nf index 94921f1d..587e01cc 100644 --- a/target/nextflow/umi_tools/umi_tools_dedup/main.nf +++ b/target/nextflow/umi_tools/umi_tools_dedup/main.nf @@ -1,8 +1,8 @@ // umi_tools_dedup main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1731,7 +1731,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1802,7 +1804,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1844,7 +1848,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3480,15 +3486,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/umi_tools/umi_tools_dedup", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3747,7 +3754,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3878,7 +3889,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3886,8 +3898,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3924,6 +3936,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3935,10 +3948,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/umi_tools/umi_tools_extract/.config.vsh.yaml b/target/nextflow/umi_tools/umi_tools_extract/.config.vsh.yaml index 7cac5674..7a3e1899 100644 --- a/target/nextflow/umi_tools/umi_tools_extract/.config.vsh.yaml +++ b/target/nextflow/umi_tools/umi_tools_extract/.config.vsh.yaml @@ -448,15 +448,16 @@ build_info: engine: "docker|native" output: "target/nextflow/umi_tools/umi_tools_extract" executable: "target/nextflow/umi_tools/umi_tools_extract/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/umi_tools/umi_tools_extract/main.nf b/target/nextflow/umi_tools/umi_tools_extract/main.nf index 3ca24d30..2ed75d70 100644 --- a/target/nextflow/umi_tools/umi_tools_extract/main.nf +++ b/target/nextflow/umi_tools/umi_tools_extract/main.nf @@ -1,8 +1,8 @@ // umi_tools_extract main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1728,7 +1728,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1799,7 +1801,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1841,7 +1845,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3309,15 +3315,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/umi_tools/umi_tools_extract", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3574,7 +3581,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3705,7 +3716,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3713,8 +3725,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3751,6 +3763,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3762,10 +3775,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports diff --git a/target/nextflow/umi_tools/umi_tools_prepareforrsem/.config.vsh.yaml b/target/nextflow/umi_tools/umi_tools_prepareforrsem/.config.vsh.yaml index 91b508ea..3ff8fd0e 100644 --- a/target/nextflow/umi_tools/umi_tools_prepareforrsem/.config.vsh.yaml +++ b/target/nextflow/umi_tools/umi_tools_prepareforrsem/.config.vsh.yaml @@ -255,15 +255,16 @@ build_info: engine: "docker|native" output: "target/nextflow/umi_tools/umi_tools_prepareforrsem" executable: "target/nextflow/umi_tools/umi_tools_prepareforrsem/main.nf" - viash_version: "0.9.0-RC7" - git_commit: "124d50ce5318b612e4a1e4da1be705523cd6eab7" - git_remote: "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + viash_version: "0.9.0" + git_commit: "38f635ad57ef05550bba3a0864c81627f84f5ad2" + git_remote: "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox" + git_tag: "v0.2.0-2-g38f635a" package_config: name: "biobox" version: "main" description: "A collection of bioinformatics tools for working with sequence data.\n" info: null - viash_version: "0.9.0-RC7" + viash_version: "0.9.0" source: "src" target: "target" config_mods: diff --git a/target/nextflow/umi_tools/umi_tools_prepareforrsem/main.nf b/target/nextflow/umi_tools/umi_tools_prepareforrsem/main.nf index 60a22a14..60b90d29 100644 --- a/target/nextflow/umi_tools/umi_tools_prepareforrsem/main.nf +++ b/target/nextflow/umi_tools/umi_tools_prepareforrsem/main.nf @@ -1,8 +1,8 @@ // umi_tools_prepareforrsem main // -// This wrapper script is auto-generated by viash 0.9.0-RC7 and is thus a -// derivative work thereof. This software comes with ABSOLUTELY NO WARRANTY from -// Data Intuitive. +// This wrapper script is auto-generated by viash 0.9.0 and is thus a derivative +// work thereof. This software comes with ABSOLUTELY NO WARRANTY from Data +// Intuitive. // // The component may contain files which fall under a different license. The // authors of this component should specify the license in the header of such @@ -1728,7 +1728,9 @@ def publishStates(Map args) { def yamlFilename = yamlTemplate_ .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) // TODO: do the pathnames in state_ match up with the outputFilenames_? @@ -1799,7 +1801,9 @@ def publishStatesByConfig(Map args) { def yamlTemplate = params.containsKey("output_state") ? params.output_state : '$id.$key.state.yaml' def yamlFilename = yamlTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) def yamlDir = java.nio.file.Paths.get(yamlFilename).getParent() // the processed state is a list of [key, value, inputPath, outputFilename] tuples, where @@ -1841,7 +1845,9 @@ def publishStatesByConfig(Map args) { // instantiate the template def filename = filenameTemplate .replaceAll('\\$id', id_) + .replaceAll('\\$\\{id\\}', id_) .replaceAll('\\$key', key_) + .replaceAll('\\$\\{key\\}', key_) if (par.multiple) { // if the parameter is multiple: true, the filename // should contain a wildcard '*' that is replaced with @@ -3114,15 +3120,16 @@ meta = [ "runner" : "nextflow", "engine" : "docker|native", "output" : "target/nextflow/umi_tools/umi_tools_prepareforrsem", - "viash_version" : "0.9.0-RC7", - "git_commit" : "124d50ce5318b612e4a1e4da1be705523cd6eab7", - "git_remote" : "https://x-access-token:ghs_royCfknE2TdPwJPOM1bW31Qho8HPrM4SPutG@github.com/viash-hub/biobox" + "viash_version" : "0.9.0", + "git_commit" : "38f635ad57ef05550bba3a0864c81627f84f5ad2", + "git_remote" : "https://x-access-token:ghs_wFnCgH6LWyegjU3sAMvKhUKRQxXHxx2DXwds@github.com/viash-hub/biobox", + "git_tag" : "v0.2.0-2-g38f635a" }, "package_config" : { "name" : "biobox", "version" : "main", "description" : "A collection of bioinformatics tools for working with sequence data.\n", - "viash_version" : "0.9.0-RC7", + "viash_version" : "0.9.0", "source" : "src", "target" : "target", "config_mods" : [ @@ -3301,7 +3308,11 @@ def vdsl3WorkflowFactory(Map args, Map meta, String rawScript) { val = val.join(par.multiple_sep) } if (par.direction == "output" && par.type == "file") { - val = val.replaceAll('\\$id', id).replaceAll('\\$key', key) + val = val + .replaceAll('\\$id', id) + .replaceAll('\\$\\{id\\}', id) + .replaceAll('\\$key', key) + .replaceAll('\\$\\{key\\}', key) } [parName, val] } @@ -3432,7 +3443,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def createParentStr = meta.config.allArguments .findAll { it.type == "file" && it.direction == "output" && it.create_parent } .collect { par -> - "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent \\\"\" + (args[\"${par.plainName}\"] instanceof String ? args[\"${par.plainName}\"] : args[\"${par.plainName}\"].join('\" \"')) + \"\\\"\" : \"\" }" + def contents = "args[\"${par.plainName}\"] instanceof List ? args[\"${par.plainName}\"].join('\" \"') : args[\"${par.plainName}\"]" + "\${ args.containsKey(\"${par.plainName}\") ? \"mkdir_parent '\" + escapeText(${contents}) + \"'\" : \"\" }" } .join("\n") @@ -3440,8 +3452,8 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def inputFileExports = meta.config.allArguments .findAll { it.type == "file" && it.direction.toLowerCase() == "input" } .collect { par -> - def viash_par_contents = "(viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName})" - "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}=\\\"\" + ${viash_par_contents} + \"\\\"\"}" + def contents = "viash_par_${par.plainName} instanceof List ? viash_par_${par.plainName}.join(\"${par.multiple_sep}\") : viash_par_${par.plainName}" + "\n\${viash_par_${par.plainName}.empty ? \"\" : \"export VIASH_PAR_${par.plainName.toUpperCase()}='\" + escapeText(${contents}) + \"'\"}" } // NOTE: if using docker, use /tmp instead of tmpDir! @@ -3478,6 +3490,7 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { def procStr = """nextflow.enable.dsl=2 | + |def escapeText = { s -> s.toString().replaceAll("'", "'\\\"'\\\"'") } |process $procKey {$drctvStrs |input: | tuple val(id)$inputPaths, val(args), path(resourcesDir, stageAs: ".viash_meta_resources") @@ -3489,10 +3502,9 @@ def _vdsl3ProcessFactory(Map workflowArgs, Map meta, String rawScript) { |$stub |\"\"\" |script:$assertStr - |def escapeText = { s -> s.toString().replaceAll('([`"])', '\\\\\\\\\$1') } |def parInject = args | .findAll{key, value -> value != null} - | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}=\\\"\${escapeText(value)}\\\""} + | .collect{key, value -> "export VIASH_PAR_\${key.toUpperCase()}='\${escapeText(value)}'"} | .join("\\n") |\"\"\" |# meta exports